EY660149

Overview
NameEY660149
Unique NameEY660149
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY660149 vs. ExPASy Swiss-Prot
Match: IST1L_DICDI (IST1-like protein OS=Dictyostelium discoideum GN=DDB_G0289029 PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.347e-11
Identity = 48/193 (24.87%), Postives = 99/193 (51.30%), Query Frame = 3
Query:  120 KCKSLIKLVKNRIDVIRRKRNATQKFLKKDIADLLSNGLDINAYGRADGLLAELNVSFCYDFVEQCCDFVYKSLSVMQRLSACPMDCREVVSSLMFAAARFSDLPELRDLRHIFYEKYGNSLEHFANM--------EFVEKLSSKPATMDKKI--QLMQDIASEYSIRW---DSQAFQQRMSKPSASVQDQPR 659
            K K  +KL  +RI +++ K+    +  K+++A+LL    + +A  R + ++ +  +  C+  +E  C+ ++  ++++   +  P++ +E + +L++++ R   +PEL  +++    KYG  LE+ AN         + V KLS   AT D  I  Q + +IA ++++ W   D     Q +      VQ QP+
Sbjct:   12 KLKVQLKLAVSRIQILKNKKANIVRDEKRNVAELLRKKNEESARIRVETIIRDEYLIECFQIIEVLCELLHARINLINATTEMPLEMKESIFTLVYSSQRIQ-IPELEQIKNQLKAKYGKGLENEANCHCSTHVNPKIVHKLSY--ATPDPSIIFQTLSEIAEKFNVDWCGSDYPPPPQLIMPQPIIVQQQPQ 201          
The following BLAST results are available for this feature:
BLAST of EY660149 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
IST1L_DICDI3.347e-1124.87IST1-like protein OS=Dictyostelium discoideum GN=D... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-019-A12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY660149 ID=EY660149; Name=EY660149; organism=Citrus sinensis; type=EST; length=901bp
ATCTGTTCGTTTTGAAATTTCTCTTTTAAATTTTGAAAACCGCAACGGTC
ACTATATCTGTTCGAGCTAAACCGAGGACGAAGATGCTGGACGGATTGTT
AGGTCGAGGTTTTGCCTCTAAGTGTAAGTCGTTGATAAAATTGGTAAAGA
ATCGGATCGATGTGATAAGAAGAAAGAGAAATGCTACTCAGAAATTTCTG
AAGAAAGATATTGCTGATCTGCTCTCTAATGGACTCGACATTAATGCTTA
TGGCAGGGCCGACGGTCTACTAGCTGAGCTGAACGTTTCGTTTTGTTATG
ATTTTGTTGAGCAATGCTGTGATTTTGTTTACAAGAGTCTTTCAGTTATG
CAGAGACTCAGTGCTTGCCCCATGGACTGCAGAGAGGTTGTATCGTCCCT
GATGTTTGCTGCTGCAAGATTTTCTGATCTGCCAGAGTTGCGTGACCTTA
GGCATATATTCTATGAGAAATACGGAAATTCCTTGGAACACTTTGCGAAT
ATGGAGTTTGTGGAGAAATTATCTTCCAAGCCAGCTACAATGGATAAAAA
GATTCAGTTAATGCAAGATATTGCATCAGAGTATTCCATCAGATGGGACT
CCCAAGCTTTTCAACAAAGGATGTCAAAACCCTCTGCATCTGTCCAGGAC
CAACCTAGAGATTGTGGTTATTTTAGTGTCTCTAATGATAAATACAAGTC
AATCAATGCCAAGGACACCATACCAAATGAAGACAATCATGATGTTTCAT
ATAAAGATAGGATTGATGGGCACAGATCACACATTGGTAGAGAGGATAAT
GCCGCAGTTAGAATTGAGCCTAGCTTTCAGCCAGATTGGCATCCCTCAGC
ATGGATTCAGNCCACTCATGGCAGAGAAGAAGCAGCCAAAATGGATGATA
T
back to top