EY660148

Overview
NameEY660148
Unique NameEY660148
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length913
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY660148 vs. ExPASy Swiss-Prot
Match: EXOC2_ARATH (Exocyst complex component 2 OS=Arabidopsis thaliana GN=SEC5A PE=1 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 4.537e-97
Identity = 158/232 (68.10%), Postives = 199/232 (85.78%), Query Frame = 1
Query:   16 SELAQNKSNKESQHLQNGYSSDPCTESLSDIPGSVVDPHQRLLIVISNIGYCKDELSSELYNKYKDIWLQSREKDQEGTDIQDLVMSFSGLEEKVLEQYTFAKANLIRTAATTFLLDSGVQWGAAPAVKGVRDVAVELLHTLVAVHAEVFAGAKPLLDKTLGILVEGLIDTFLSLFDENQSNNLKSLDANGFCQLMLELDYFETILNPYFTHDARESLKNLQGVLLEKATVS 711
            ++L+Q+ S +++   +NGYS +   E  ++  GSV+DPH+RLL+V+SNIGYCKDEL+SELYNK+K  WLQSR+K+++ +D+QDL+MSFSGL EKVLE YTFAKANLIRTAAT +LLDSG+QWG+AP VKG+RD AVELLHTLVAVHAEVFAGAKPLLDK LG+L+EGLIDTFLS+ +EN+S++L+S+DANGFCQLM EL+YFET+L  YFT  A ESLK+LQG +LE A  S
Sbjct:  753 ADLSQSTSRQDNW--KNGYSDEHQEEPSANTYGSVIDPHRRLLMVLSNIGYCKDELASELYNKFKYTWLQSRDKNEDSSDLQDLIMSFSGLGEKVLEHYTFAKANLIRTAATNYLLDSGIQWGSAPQVKGIRDAAVELLHTLVAVHAEVFAGAKPLLDKILGVLIEGLIDTFLSVVEENRSSDLRSIDANGFCQLMFELEYFETVLYSYFTSAATESLKSLQGTVLEIAIES 982          

HSP 2 Score: 52.373 bits (124), Expect = 4.537e-97
Identity = 25/48 (52.08%), Postives = 33/48 (68.75%), Query Frame = 3
Query:  732 PGHHRRPTRGSEDALADERQQGMTVSPDDLIALDSSIAQSCFQQSLRR 875
            PGH+RRPTRGSED ++D++Q   +VS DDL+AL    +    QQ L R
Sbjct:  990 PGHNRRPTRGSEDTVSDDKQ---SVSADDLLALTKQCSNELLQQELER 1034          
The following BLAST results are available for this feature:
BLAST of EY660148 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
EXOC2_ARATH4.537e-9768.10Exocyst complex component 2 OS=Arabidopsis thalian... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-019-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY660148 ID=EY660148; Name=EY660148; organism=Citrus sinensis; type=EST; length=913bp
CCACGCGTCCGTGCAAGTGAGCTTGCCCAAAACAAATCAAACAAAGAAAG
TCAACATTTACAAAATGGATATTCTTCTGATCCATGCACAGAATCATTGT
CTGATATCCCTGGAAGTGTTGTTGATCCACACCAAAGACTGTTGATTGTA
ATAAGCAATATTGGGTATTGCAAAGATGAGCTTTCTTCTGAGCTATATAA
CAAATATAAAGATATCTGGCTTCAATCTAGGGAAAAAGATCAGGAGGGCA
CTGATATACAAGATCTAGTGATGTCTTTTTCTGGACTTGAAGAGAAGGTC
CTTGAGCAGTACACATTTGCAAAGGCAAACTTGATAAGAACAGCAGCCAC
TACATTTTTGTTGGATTCTGGTGTTCAATGGGGAGCGGCACCGGCAGTCA
AAGGTGTGCGTGATGTAGCTGTGGAATTATTGCACACACTGGTAGCCGTA
CATGCAGAGGTCTTTGCTGGTGCTAAGCCCCTCTTAGACAAGACACTTGG
CATTCTTGTGGAAGGTCTGATTGACACATTTCTTAGCCTGTTTGATGAAA
ACCAATCCAATAATCTTAAGTCACTTGATGCAAATGGTTTCTGCCAGCTC
ATGCTCGAGCTTGACTATTTTGAGACCATATTGAATCCATATTTCACACA
TGATGCTAGAGAGTCCTTGAAAAATTTGCAAGGGGTGCTATTGGAAAAGG
CCACTGTAAGTGTTGCTGANGCTGTAGAGATCCAGGTCATCATCGCCGAC
CAACTCGTGGAAGTGAAGATGCACTTGCAGATGAAAGACAGCAAGGAATG
ACTGTATCACCTGATGATTTGATTGCTCTTGACAGCAGTATAGCTCAGAG
TTGCTTTCAGCAGAGCTTGAGAAGACTCGTATCATACAGCATGCTTCGTG
GNATCACTTCCAT
back to top