EY659957

Overview
NameEY659957
Unique NameEY659957
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659957_ssr105 microsatellite EY659957_ssr105:105..118. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2317 contig Csv1_Contig2317:245..1165. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659957 vs. ExPASy Swiss-Prot
Match: Y5621_ARATH (PHD finger protein At5g26210 OS=Arabidopsis thaliana GN=At5g26210 PE=1 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 4.307e-62
Identity = 133/241 (55.19%), Postives = 148/241 (61.41%), Query Frame = 1
Query:  208 MDGGGGYNPRTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWXXXXXXXXXXXXXXXXXXGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINELPTIFEVVTGTTKKQAXXXXXXXXXXXXXXXXXXXRGSETQAKFSKAVQSKXXXXXXXXXXXXXXXXXXXXXXXXXXXCSRWSLDLL*C--L*E-WVHGKGGKITPAGAEHI 921
            M+ GG YNPRTVEEVF DFKGRRAGMIKALTT+V+EF+  CDPEKENLCLYG P+E W                  GINFARDGM EKDWLSLVAVHSDAWLL+VAF+FGARFGFDK+DRKRLFNM+N+LPTIFEVV GT KKQ                    RGSE++AKFSK  + K                            S  + +   C  L E W HGK  KITPA AEHI
Sbjct:    1 MEAGGAYNPRTVEEVFRDFKGRRAGMIKALTTDVQEFFRLCDPEKENLCLYGHPNEHWEVNLPAEEVPPELPEPVLGINFARDGMAEKDWLSLVAVHSDAWLLAVAFFFGARFGFDKADRKRLFNMVNDLPTIFEVVAGTAKKQGKDKSSVSNNSSNRSKSSSKRGSESRAKFSKP-EPKDDEEEEEEGVEEEDEDEQGETQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHI 240          
The following BLAST results are available for this feature:
BLAST of EY659957 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y5621_ARATH4.307e-6255.19PHD finger protein At5g26210 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-016-H12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659957 ID=EY659957|Name=EY659957|organism=Citrus sinensis|type=EST|length=922bp
AAATGGTAGCCTGCGGTACGGTCCGGAATTCTTTCAAAAGGGGGCGTNNG
NTTTTTGTTTACAGAGAGGAGGGTATTTTCACATCTTTCCCTCCTTTACT
CTTACTCTCTCTCTCTCTCCCCAATTTCGAACTTCGATCTCTCTTCTCTG
TAAATCTGAAAACAAACGACGAAAAAGAAAAAGAGTGCGAGAGAATTTGA
TTCGGTGATGGACGGAGGTGGAGGCTACAATCCGCGTACGGTTGAAGAAG
TTTTTGGGGATTTCAAGGGCCGAAGAGCTGGCATGATTAAAGCCCTTACT
ACTGAGGTTGAAGAGTTTTACCACCAGTGTGACCCTGAGAAGGAAAATCT
TTGCCTCTACGGTTTTCCAAGCGAGCAGTGGGAGGTAAACTTACCTGCTG
AAGAAGTGCCTCCAGAGCTTCCAGAGCCTGCATTGGGTATCAACTTTGCC
AGAGATGGGATGCAAGAAAAGGACTGGTTGTCTTTGGTTGCTGTCCACAG
TGATGCTTGGTTACTCTCCGTGGCCTTTTACTTTGGTGCTAGGTTTGGTT
TTGATAAATCTGATAGGAAACGCCTTTTTAATATGATAAATGAACTTCCA
ACAATATTTGAGGTTGTGACAGGGACAACAAAGAAACAGGCAAAAGAAAA
GTCTTCTGTGTCAAATCACAGTAGCAGCAAATCTAAATCAAACTCAAAGC
GAGGCTCTGAAACTCAAGCCAAGTTTTCAAAGGCAGTGCAATCAAAGGAT
GAAGAAGATGAAGGTCTGGGAGAGGGAGATGAGGAGGAGCATGGGGAGAC
ACTGTGTGGGGGCTTGGGGGGAGAACTATGCAGCCGATGGAGTCTGGATT
TGCTGTGATGTCTGTGAGAATGGGTTCATGGGAAAGGGGGTAAGATCACC
CCAGCAGGGGCTGAGCACATTA
back to top