EY659953

Overview
NameEY659953
Unique NameEY659953
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length861
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7517 contig Csv1_Contig7517:1..861. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: SVOP_XENLA (Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.088e-23
Identity = 77/261 (29.50%), Postives = 112/261 (42.91%), Query Frame = 1
Query:   34 IPAFVLLIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLFSPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQDASV---------YINVFITSFAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVA 789
            +P  +  I   ++PES RY    G    A   L +IA  N   +P G L                   ++S    R  +R         LFSP+F  TT+LLW ++F N+F YYG+VLL                        S+         Y ++  T+ +E PGLL    ++DRVGRK +M I FI      L L       +LT  L  AR F  G F  A ++ PE+YPT+ R+ G G    + ++  ++ P +A
Sbjct:  246 LPLMLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKL-------------------IVSRQEDRGKIRD--------LFSPQFRCTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISNQRKAVKPKCSLACEYLTVEDYTDLLWTTLSEFPGLLVTLWIIDRVGRKKTMAICFIIFSFSALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIA 479          
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: SVOP_RAT (Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.015e-22
Identity = 77/274 (28.10%), Postives = 120/274 (43.80%), Query Frame = 1
Query:   37 PAFVLLIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLFSPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQDASV---------YINVFITSFAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVA-VGLVTXCHQTAAI 828
            P  V  +   ++PES RY    G    A   L +IA  N   +P G L                   ++S    R  +R         LF+P F  TT+LLW ++F N+F YYG+VLL                        S+         Y+++  T+ +E PG+L    ++DR+GRK +M + F+   +  L L       +LT LL  AR F  G F  A ++ PE+YPT+ R+ G G    + ++  ++ P +A V L +  + T A+
Sbjct:  247 PLLVFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKL-------------------IISRQEDRGKMRD--------LFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISSRKKAVEAKCSLACEYLSKEDYMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFVIFSLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYLTLAV 493          
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: SVOP_PONAB (Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.015e-22
Identity = 76/275 (27.64%), Postives = 120/275 (43.64%), Query Frame = 1
Query:   34 IPAFVLLIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLFSPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQDASV---------YINVFITSFAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVA-VGLVTXCHQTAAI 828
            +P  +  +   ++PES RY    G    A   L +IA  N   +P G L                   ++S    R  +R         LF+P F  TT+LLW ++F N+F YYG+VLL                        S+         Y+++  T+ +E PG+L    ++DR+GRK +M + F+      L L       +LT LL  AR F  G F  A ++ PE+YPT+ R+ G G    + ++  ++ P +A V L +  + T A+
Sbjct:  246 VPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKL-------------------IISRQEDRGKMRD--------LFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCGISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYLTLAV 493          
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: SVOP_HUMAN (Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.015e-22
Identity = 76/275 (27.64%), Postives = 120/275 (43.64%), Query Frame = 1
Query:   34 IPAFVLLIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLFSPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQDASV---------YINVFITSFAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVA-VGLVTXCHQTAAI 828
            +P  +  +   ++PES RY    G    A   L +IA  N   +P G L                   ++S    R  +R         LF+P F  TT+LLW ++F N+F YYG+VLL                        S+         Y+++  T+ +E PG+L    ++DR+GRK +M + F+      L L       +LT LL  AR F  G F  A ++ PE+YPT+ R+ G G    + ++  ++ P +A V L +  + T A+
Sbjct:  246 VPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKL-------------------IISRQEDRGKMRD--------LFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCGISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYLTLAV 493          
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: SVOP_BOVIN (Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.015e-22
Identity = 76/275 (27.64%), Postives = 120/275 (43.64%), Query Frame = 1
Query:   34 IPAFVLLIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLFSPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQDASV---------YINVFITSFAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVA-VGLVTXCHQTAAI 828
            +P  +  +   ++PES RY    G    A   L +IA  N   +P G L                   ++S    R  +R         LF+P F  TT+LLW ++F N+F YYG+VLL                        S+         Y+++  T+ +E PG+L    ++DR+GRK +M + F+      L L       +LT LL  AR F  G F  A ++ PE+YPT+ R+ G G    + ++  ++ P +A V L +  + T A+
Sbjct:  246 VPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKL-------------------IISRQEDRGKMRD--------LFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVVFSFCSLLLFICVGRNMLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYLTLAV 493          
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: SVOP_MOUSE (Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.143e-22
Identity = 77/274 (28.10%), Postives = 120/274 (43.80%), Query Frame = 1
Query:   37 PAFVLLIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLFSPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQDASV---------YINVFITSFAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVA-VGLVTXCHQTAAI 828
            P  +  +   ++PES RY    G    A   L +IA  N   +P G L                   ++S    R  +R         LF+P F  TT+LLW ++F N+F YYG+VLL                        S+         Y+++  T+ +E PG+L    ++DR+GRK +M + FI   +  L L       +LT LL  AR F  G F  A ++ PE+YPT+ R+ G G    + ++  ++ P +A V L +  + T A+
Sbjct:  247 PLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKL-------------------IISRQEDRGKMRD--------LFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISSRKKAVEAKCSLACEYLSKEDYMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFIIFSLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYLTLAV 493          
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: YOU1_CAEEL (Putative transporter ZK637.1 OS=Caenorhabditis elegans GN=ZK637.1 PE=3 SV=5)

HSP 1 Score: 102.449 bits (254), Expect = 3.334e-21
Identity = 77/283 (27.21%), Postives = 115/283 (40.64%), Query Frame = 1
Query:   34 IPAFVLLIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLFSPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQDA------SVYINVFITSFAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVA-------VGLVTXCHQTAAILLLEA 843
            +P  +  +   ++PES R+    G    A   L   A+ N+  LP+G L S                         T            L SP   KTTILLW ++   +F YYG+VL                       +       S Y ++  T+ AE PGL+   L+++  GRK +M + +    IF   L        +T L+  AR F  G F  A ++ PE+YPT++R+ G G   A+ +I  +V P +A       + L    + TAAIL L A
Sbjct:  245 LPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSS------------------------TKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDECHGGLFSNGTQMEVCQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQVASEKSLSLPIGIYGTAAILGLIA 503          
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: SVOPL_DANRE (Putative transporter SVOPL OS=Danio rerio GN=svopl PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.893e-16
Identity = 71/270 (26.30%), Postives = 112/270 (41.48%), Query Frame = 1
Query:   34 IPAFVLLIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLFSPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQ-------------DASVYINVFITSFAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVAVGLVT 804
            IP+ VL+    F+PES R+  + G I  A + L +IA+ N   LP G L         E         L+SSA                     F +T++LLW  +F  SF YYG VL +                   ++             ++  Y  + I+   E+  +    +L++ VGRK SM I+ +    F + +    + +  T LL   R      F +  I+  E+YPTS+RS G G   +  +I GM+ P +A  L++
Sbjct:  227 IPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREP------EVTERGNAVTLISSA---------------------FRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDLEHQIKHIQEETLCYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMS 469          
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: S22A7_BOVIN (Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.229e-16
Identity = 70/256 (27.34%), Postives = 117/256 (45.70%), Query Frame = 1
Query:   34 IPAFVLLIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLF-SPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQDASVYINVFITSFAELPGLLTAALLVDRVGRKLSM--TIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVAV 792
            +P    ++ L ++PES R+L T+GR+ +AH  L + A+ N   +   +L+ +  N +              +A +R   R     S+L LF +PR    ++   V++FG +F YYG+ L                    +    +VY+   +    ELP  L   L V   GR+L+M  T++   + + L  LV+ +     TAL    + FS   F  A +F  E+YPT +R TG G+   V ++ G + P  A+
Sbjct:  265 LPCVPGILTLWWVPESARWLLTQGRVEEAHRYLLRCARLNGPPVGEDSLSREALNKV--------------AAAERMVRR----PSYLDLFRTPRLRYISLCCMVVWFGVNFSYYGVSL------------------DLSGLGLNVYLTQLVFGAVELPSKLLVYLSVRHAGRRLTMAGTLLGAALAVGLRILVSPEMKSWSTALAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAAL 484          
BLAST of EY659953 vs. ExPASy Swiss-Prot
Match: S22A7_RABIT (Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.022e-14
Identity = 67/250 (26.80%), Postives = 110/250 (44.00%), Query Frame = 1
Query:   52 LIFLDFMPESPRYLCTKGRITDAHNILDKIAQFNQTSLPSGNLTSDGTNDLDEEFSTSEETPLLSSARKRTTVRKSGFSSFLMLF-SPRFFKTTILLWVLYFGNSFVYYGIVLLAXXXXXXXXXXXXXXXXXENVQDASVYINVFITSFAELPGLLTAALLVDRVGRKLSM--TIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGTFIIANIFAPEIYPTSMRSTGAGVAYAVXKIXGMVCPSVAV 792
            ++ L ++PES R+L T+GR+ +A   L + A+ N   +P   L+ +  +++               A     VR+    S+L LF +PR    ++   V++FG +F YYG  L                         +VY    +    ELP  L   L V   GR+L+   T+M   + + +  LV  + +   TAL    + FS   F  A +F  E+YPT +R TG G+   V ++ G + P  A+
Sbjct:  270 ILSLWWVPESARWLLTQGRVEEAQRYLLRCARLNGRPVPQDGLSREALSEV---------------AAGERVVRRP---SYLDLFRTPRLRHISLCCMVVWFGVNFSYYGQSLAVSGLGL------------------NVYQTQLLFGAVELPSKLLVYLSVRHAGRRLTQAGTLMGAALALGIRLLVASERSSWSTALAVMGKGFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAAL 483          
The following BLAST results are available for this feature:
BLAST of EY659953 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
SVOP_XENLA2.088e-2329.50Synaptic vesicle 2-related protein OS=Xenopus laev... [more]
SVOP_RAT3.015e-2228.10Synaptic vesicle 2-related protein OS=Rattus norve... [more]
SVOP_PONAB3.015e-2227.64Synaptic vesicle 2-related protein OS=Pongo abelii... [more]
SVOP_HUMAN3.015e-2227.64Synaptic vesicle 2-related protein OS=Homo sapiens... [more]
SVOP_BOVIN3.015e-2227.64Synaptic vesicle 2-related protein OS=Bos taurus G... [more]
SVOP_MOUSE5.143e-2228.10Synaptic vesicle 2-related protein OS=Mus musculus... [more]
YOU1_CAEEL3.334e-2127.21Putative transporter ZK637.1 OS=Caenorhabditis ele... [more]
SVOPL_DANRE1.893e-1626.30Putative transporter SVOPL OS=Danio rerio GN=svopl... [more]
S22A7_BOVIN3.229e-1627.34Solute carrier family 22 member 7 OS=Bos taurus GN... [more]
S22A7_RABIT3.022e-1426.80Solute carrier family 22 member 7 OS=Oryctolagus c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-016-H08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659953 ID=EY659953|Name=EY659953|organism=Citrus sinensis|type=EST|length=861bp
TTACAAAAAGAGGTGGCTACTTGCTTTGTCTGAATACCTGCATTTGTTCT
GCTTATTTTCCTTGATTTCATGCCAGAGTCTCCAAGATATCTATGTACAA
AAGGTAGAATAACTGATGCGCATAATATTCTGGATAAAATAGCTCAATTC
AACCAAACAAGCCTCCCTTCTGGCAACCTTACTTCTGATGGAACAAATGA
TCTGGATGAAGAATTTTCTACATCAGAAGAGACTCCTCTACTCTCTTCAG
CTAGAAAAAGGACCACAGTCCGCAAATCAGGCTTCTCATCCTTTCTAATG
TTGTTCTCACCAAGATTTTTTAAAACAACCATTCTATTGTGGGTATTATA
CTTTGGCAATTCATTCGTCTATTATGGTATTGTATTGCTGGCATCTGAAC
TGAGCGGCAGTCAAAGTAAATGTAGCTCAAGCATCTTGCTTTCAGAAAAT
GTGCAGGATGCTAGTGTCTACATAAATGTATTCATCACTAGCTTTGCAGA
GCTACCTGGACTTCTTACAGCTGCATTACTTGTGGACAGAGTGGGTCGCA
AGCTTTCCATGACAATTATGTTTATCTTTGTATGTATTTTCCTGCTTCCA
CTGGTTACACTTCAGTCCAACATTTTGCTAACAGCATTATTATCCGGAGC
TCGCATGTTCTCTATGGGAACCTTTATTATCGCCAACATTTTTGCCCCCG
AGATATATCCAACTTCTATGAGATCAACTGGTGCTGGAGTTGCGTATGCT
GTANGAAAGATTGNTGGTATGGTATGCCCCTCTGTAGCTGTTGGACTAGT
GACTAGNTGCCATCAAACAGCTGCAATACTTCTATTAGAGGCTNNCTATG
TACTTTCAGAA
back to top