EY659940

Overview
NameEY659940
Unique NameEY659940
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length902
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: FIG4_MOUSE (Polyphosphoinositide phosphatase OS=Mus musculus GN=Fig4 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.189e-32
Identity = 71/148 (47.97%), Postives = 94/148 (63.51%), Query Frame = 2
Query:   65 GNHPIRLPPLQKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVIDNPKIDLDAPLADDLMGFYERMGDTLAHQYGGSAAHNKIFSERR-GQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGHFQPQQDKPALWELDSD 505
            G H I    LQ G+LRTNC+DCLDRTN AQ+  G  AL  QL++LG+ID P +  D          YE  GDTL+ QYGGS   +++ + R+   W     S++  +TL RYYSNA+ DA++QD+IN+FLG F P + KP LWEL +D
Sbjct:  468 GGHVIPTGRLQTGILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPW--TQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHPTEGKPHLWELPTD 613          
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: FIG4_HUMAN (Polyphosphoinositide phosphatase OS=Homo sapiens GN=FIG4 PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.314e-31
Identity = 68/139 (48.92%), Postives = 91/139 (65.47%), Query Frame = 2
Query:   92 LQKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVIDNPKIDLDAPLADDLMGFYERMGDTLAHQYGGSAAHNKIFSERR-GQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGHFQPQQDKPALWELDSD 505
            LQ G+LRTNC+DCLDRTN AQ+  G  AL  QL++LG+ID P +  D          YE  GDTL+ QYGGS   +++ + R+   W     S++  +TL RYYSNA+ DA++QD+IN+FLG F P + KP LWEL +D
Sbjct:  477 LQTGILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPW--TQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHPTEGKPHLWELPTD 613          
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: FIG4_YEAST (Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae GN=FIG4 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.824e-31
Identity = 62/139 (44.60%), Postives = 101/139 (72.66%), Query Frame = 2
Query:   92 LQKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVIDNPKIDLDAPLADDLMGFYERMGDTLAHQYGGSAAHNKIFSERR-GQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGHFQPQQDKPALWELDSD 505
            +Q+G+ R+NCIDCLDRTN AQ+  G  ALG QL +LG+IDN  ++ D+ + + L   +  +GDT+A QYGGS   N + + R+  QW  ++ S++   +++R+YSN+++DA++QDAIN+FLGH+  ++  P+LWE+++D
Sbjct:  458 IQEGICRSNCIDCLDRTNAAQFVIGKRALGCQLKSLGIIDNSYLEYDSDIVNILTELFHDLGDTIALQYGGSHLVNTMETYRKINQW--SSHSRDMIESIKRFYSNSFVDAQRQDAINLFLGHYSWREGFPSLWEMNTD 594          
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: YLE3_SCHPO (Uncharacterized protein C1093.03 OS=Schizosaccharomyces pombe GN=SPAC1093.03 PE=2 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 3.467e-24
Identity = 54/123 (43.90%), Postives = 84/123 (68.29%), Query Frame = 2
Query:   95 QKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVIDNPKIDLDAPLADDLMGFYERMGDTLAHQYGGSAAHNKIFSERR-GQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGHF 460
            Q GV+RTNC+DCLDRTN AQ+  G   L  QL ALGV+D+P++D ++     L   Y   GD +A QYGGS   N + + R+  QW  ++ S++   +++R+YSN+++D ++Q+AI++FLG+F
Sbjct:  418 QTGVVRTNCVDCLDRTNAAQFVIGKCVLAAQLRALGVLDSPQLDYESDAVRLLAEMYHGHGDAIALQYGGSLLVNTLDTYRKNNQW--SSTSRDLIESVKRFYSNSFVDFQRQEAISLFLGNF 538          
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: SAC2_DANRE (Phosphatidylinositide phosphatase SAC2 OS=Danio rerio GN=inpp5f PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.108e-13
Identity = 44/121 (36.36%), Postives = 66/121 (54.55%), Query Frame = 2
Query:   95 QKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVIDNPKIDLDAPLADDLMGFYERMGDTLAHQYGGSAAHNKIFSERRGQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGH 457
            Q+G+ R NC+DCLDRTNV Q A     + +QL  LGV+  P+  L           +   GDT++ QY G+AA    F+ R G+ + A   ++   +  RYY N + DA +Q  I++ +GH
Sbjct:  450 QEGIFRVNCMDCLDRTNVVQAAIARVIMEQQLKKLGVMP-PEQPLPLKCYRIYQVMWANNGDTISRQYAGTAALKGDFT-RTGERKLAGVMKDGVNSANRYYLNRFRDAYRQAVIDLMMGH 568          
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: SAC1_DROME (Phosphatidylinositide phosphatase SAC1 OS=Drosophila melanogaster GN=Sac1 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.596e-13
Identity = 46/129 (35.66%), Postives = 71/129 (55.04%), Query Frame = 2
Query:   80 RLPPLQKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVID-NPKIDLDAPLADDLM-GFYERMGDTLAHQYGGSAAHNKIFSERRGQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGHF 460
            +L   Q GV RTNCIDCLDRTNV Q      +L   L  LGV+    K++  + + + +  G +    D ++ QY G+ A    F+ R G+   +   Q+   +L RYY N + D ++QD+I++FLG +
Sbjct:  375 KLVSTQTGVFRTNCIDCLDRTNVVQSMLARRSLTAVLQKLGVLHVGQKVEHASDIFESIFKGVWADNADLVSLQYSGTCALKTDFT-RTGKRTKSGAMQDGKNSLMRYYLNNFADGQRQDSIDLFLGKY 502          
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: SAC2_HUMAN (Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3)

HSP 1 Score: 71.633 bits (174), Expect = 6.781e-12
Identity = 51/172 (29.65%), Postives = 84/172 (48.84%), Query Frame = 2
Query:   95 QKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVIDNPKIDLDAPLADDLMGFYERMGDTLAHQYGGSAAHNKIFSERRGQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGHFQPQQDKPALWELDSDQ---HYGMGRNGQTNVDEDGRSFFKRSLSDGNILH 601
            Q+G+ R NC+DCLDRTNV Q A     + +QL  LGV+  P+  L           +   GD+++ QY G+AA    F+ R G+ + A   ++   +  RYY N + DA +Q  I++  G     +D  +++  + +    H    R+ Q  + +  +S+ K  L D    H
Sbjct:  450 QEGIFRVNCMDCLDRTNVVQAAIARVVMEQQLKKLGVMP-PEQPLPVKCNRIYQIMWANNGDSISRQYAGTAALKGDFT-RTGERKLAGVMKDGVNSANRYYLNRFKDAYRQAVIDLMQG-IPVTEDLYSIFTKEKEHEALHKENQRSHQELISQLLQSYMKLLLPDDEKFH 618          
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: SAC1_YEAST (Phosphoinositide phosphatase SAC1 OS=Saccharomyces cerevisiae GN=SAC1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.781e-12
Identity = 43/137 (31.39%), Postives = 68/137 (49.64%), Query Frame = 2
Query:   59 ANGNHPIRLPPLQKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVIDNPKI-DLDAPLADDLMGFYERMGDTLAHQYGGSAAHNKIFSERRGQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGHFQP 466
            +NGN  + +   Q  V+RTNC+DCLDRTNV Q       L ++  +  V+      + +APL       +    D ++  Y G+ A    F+ R G+        +F  +  RYY N + D  +QD+ ++FLG F+P
Sbjct:  373 SNGN-TVEIVNEQHSVVRTNCMDCLDRTNVVQSVLAQWVLQKEFESADVVATGSTWEDNAPLLTSYQNLWADNADAVSVAYSGTGALKTDFT-RTGKRTRLGAFNDFLNSASRYYQNNWTDGPRQDSYDLFLGGFRP 507          
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: SAC1_RAT (Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.157e-11
Identity = 43/123 (34.96%), Postives = 64/123 (52.03%), Query Frame = 2
Query:   95 QKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVID-NPKIDLDAPLADDLMGFYERMGDTLAHQYGGSAAHNKIFSERRGQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGHF 460
            Q+GV R+NC+DCLDRTNV Q      +L  QL  LGV+    K++            +    +  A QY G+ A    F+ R G+        + F +L RYY N + D  +QD+I++FLG++
Sbjct:  381 QEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFT-RTGKRTQLGLVMDGFNSLLRYYKNNFSDGFRQDSIDLFLGNY 502          
BLAST of EY659940 vs. ExPASy Swiss-Prot
Match: SAC1_MOUSE (Phosphatidylinositide phosphatase SAC1 OS=Mus musculus GN=Sacm1l PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.157e-11
Identity = 43/123 (34.96%), Postives = 63/123 (51.22%), Query Frame = 2
Query:   95 QKGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHALGVID-NPKIDLDAPLADDLMGFYERMGDTLAHQYGGSAAHNKIFSERRGQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGHF 460
            Q GV R+NC+DCLDRTNV Q      +L  QL  LGV+    K++            +    +  A QY G+ A    F+ R G+        + F +L RYY N + D  +QD+I++FLG++
Sbjct:  381 QDGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKTYKNAWADNANACAKQYAGTGALKTDFT-RTGKRTQLGLLMDGFNSLLRYYKNNFSDGFRQDSIDLFLGNY 502          
The following BLAST results are available for this feature:
BLAST of EY659940 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
FIG4_MOUSE1.189e-3247.97Polyphosphoinositide phosphatase OS=Mus musculus G... [more]
FIG4_HUMAN1.314e-3148.92Polyphosphoinositide phosphatase OS=Homo sapiens G... [more]
FIG4_YEAST3.824e-3144.60Polyphosphoinositide phosphatase OS=Saccharomyces ... [more]
YLE3_SCHPO3.467e-2443.90Uncharacterized protein C1093.03 OS=Schizosaccharo... [more]
SAC2_DANRE2.108e-1336.36Phosphatidylinositide phosphatase SAC2 OS=Danio re... [more]
SAC1_DROME3.596e-1335.66Phosphatidylinositide phosphatase SAC1 OS=Drosophi... [more]
SAC2_HUMAN6.781e-1229.65Phosphatidylinositide phosphatase SAC2 OS=Homo sap... [more]
SAC1_YEAST6.781e-1231.39Phosphoinositide phosphatase SAC1 OS=Saccharomyces... [more]
SAC1_RAT1.157e-1134.96Phosphatidylinositide phosphatase SAC1 OS=Rattus n... [more]
SAC1_MOUSE1.157e-1134.96Phosphatidylinositide phosphatase SAC1 OS=Mus musc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-016-G07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659940 ID=EY659940|Name=EY659940|organism=Citrus sinensis|type=EST|length=902bp
TCCAACAACCCCGCGTCCGTGACAAGTTTCCCCAAAAATTAGTGGAGATA
AAAATGTTGCTAATGGAAATCATCCTATCAGGCTTCCCCCGTTACAAAAG
GGTGTGCTGAGGACCAATTGCATAGACTGCCTGGACCGTACAAATGTTGC
GCAGTATGCTTATGGGTTGGCTGCTCTTGGACGCCAACTTCATGCTCTAG
GAGTTATAGATAACCCGAAGATTGACCTGGATGCTCCATTGGCTGATGAT
TTGATGGGGTTCTATGAGAGAATGGGTGACACACTAGCACATCAGTACGG
TGGCTCAGCGGCTCATAATAAGATATTCTCTGAAAGAAGGGGACAGTGGA
GAGCAGCTACCCAGTCCCAAGAGTTTTTCAGAACTCTTCAACGGTATTAT
AGCAATGCATACATGGATGCGGAGAAACAAGATGCGATTAATGTATTTCT
GGGGCACTTCCAGCCACAACAGGATAAACCTGCACTCTGGGAGCTGGATT
CAGACCAGCATTACGGTATGGGAAGGAATGGGCAAACAAATGTCGATGAA
GATGGAAGGTCATTTTTCAAAAGATCCCTATCTGATGGAAACATTCTTCA
TGAAACTGGCTCAGCCATGTCAGCCACAAATGTCAATGAGGAGAAATTTT
CAAGTTCAGGTCTCCCCAATCAGTTGCGGAATAGAAACAATGTTCTTTCC
GAATCATCACCCGAAATATCAACTTCTGAAAGTGATGTGGCATTTTCAGG
TATACTCCCTCCATGCCTCGCAGGCAGTTCTTTGGAGATGTGCAAGAGAT
CGATACTTTGAAAGTGACATATTTACGAACATGGAGATGCGTCCAGNTCC
TCAAACTTTGTCGATTAGACTGGCTATCATCCTCTGGGAATTCATGTGAG
GA
back to top