EY659935
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY659935 vs. ExPASy Swiss-Prot
Match: GAT25_ARATH (GATA transcription factor 25 OS=Arabidopsis thaliana GN=TIFY2A PE=2 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 4.548e-16 Identity = 42/68 (61.76%), Postives = 48/68 (70.59%), Query Frame = 2 Query: 50 CQHCGISEKLTPAMPRGPAGPRTLCNACGLMWANKGTLRDLTKG----ARNICFEQHE---LETSSDI 232 C+HCGI EK TP M RGPAGPRTLCNACGLMWANKG RDL+K A+N+ ++E LET I Sbjct: 223 CRHCGIGEKSTPMMRRGPAGPRTLCNACGLMWANKGAFRDLSKASPQTAQNLPLNKNEDANLETDHQI 290
BLAST of EY659935 vs. ExPASy Swiss-Prot
Match: GAT27_ARATH (GATA transcription factor 27 OS=Arabidopsis thaliana GN=TIFY2B PE=2 SV=2) HSP 1 Score: 84.7297 bits (208), Expect = 5.939e-16 Identity = 36/44 (81.82%), Postives = 39/44 (88.64%), Query Frame = 2 Query: 47 ICQHCGISEKLTPAMPRGPAGPRTLCNACGLMWANKGTLRDLTK 178 +C+HCG SEK TP M RGP GPRTLCNACGLMWANKGTLRDL+K Sbjct: 218 LCRHCGTSEKSTPMMRRGPDGPRTLCNACGLMWANKGTLRDLSK 261
BLAST of EY659935 vs. ExPASy Swiss-Prot
Match: GAT26_ARATH (GATA transcription factor 26 OS=Arabidopsis thaliana GN=TIFY1 PE=2 SV=2) HSP 1 Score: 81.6481 bits (200), Expect = 5.028e-15 Identity = 34/43 (79.07%), Postives = 37/43 (86.05%), Query Frame = 2 Query: 50 CQHCGISEKLTPAMPRGPAGPRTLCNACGLMWANKGTLRDLTK 178 C HCGIS K TP M RGP+GPRTLCNACGL WAN+GTLRDL+K Sbjct: 214 CTHCGISSKCTPMMRRGPSGPRTLCNACGLFWANRGTLRDLSK 256 The following BLAST results are available for this feature:
BLAST of EY659935 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY659935 ID=EY659935; Name=EY659935; organism=Citrus sinensis; type=EST; length=763bpback to top |