EY659915
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY659915 vs. ExPASy Swiss-Prot
Match: Y2239_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g23950 OS=Arabidopsis thaliana GN=At2g23950 PE=2 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 2.341e-14 Identity = 38/60 (63.33%), Postives = 42/60 (70.00%), Query Frame = 2 Query: 623 NNLHDPYNGLENWDITSVDPCSWRMITCSPDGYVSALGLPSQSLSGT*SRWIGNLTSCNQ 802 N LHDP+ +NWD SVDPCSW MI+CS D V LG PSQSLSGT S IGNLT+ Q Sbjct: 43 NELHDPHGVFKNWDEFSVDPCSWTMISCSSDNLVIGLGAPSQSLSGTLSGSIGNLTNLRQ 102
BLAST of EY659915 vs. ExPASy Swiss-Prot
Match: Y5457_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g45780 OS=Arabidopsis thaliana GN=At5g45780 PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 1.356e-12 Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 2 Query: 623 NNLHDPYNGLENWDITSVDPCSWRMITCSPDGYVSALGLPSQSLSGT*SRWIGNLTSCNQWYCRITHFR-PYPASLGK 853 N + D L WDI SVDPC+W M+ CS +G+V +L + S+ LSG S IG LT + + P P+ LG+ Sbjct: 48 NKMKDEKEVLSGWDINSVDPCTWNMVGCSSEGFVVSLEMASKGLSGILSTSIGELTHLHTLLLQNNQLTGPIPSELGQ 125 HSP 2 Score: 33.113 bits (74), Expect = 1.356e-12 Identity = 19/47 (40.43%), Postives = 26/47 (55.32%), Query Frame = 3 Query: 498 MEMKSYKF-----WRVGFLVLALIDICYATLSPAGINYEVVALVAVK 623 ME+ KF W + VL + + LSP G+NYEV AL++VK Sbjct: 1 MEISLMKFLFLGIWVYYYSVLDSVSAMDSLLSPKGVNYEVAALMSVK 47 The following BLAST results are available for this feature:
BLAST of EY659915 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY659915 ID=EY659915; Name=EY659915; organism=Citrus sinensis; type=EST; length=868bpback to top |