EY659890
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY659890 vs. ExPASy Swiss-Prot
Match: SCAM_PEA (Secretory carrier-associated membrane protein OS=Pisum sativum GN=PSAM2 PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 6.167e-13 Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 340 RTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLT 456 RTDSA+KF WFF+FYL+HIGFCI AA+APP+VF GKSLT Sbjct: 184 RTDSAIKFGWFFMFYLLHIGFCILAAVAPPIVFKGKSLT 222
BLAST of EY659890 vs. ExPASy Swiss-Prot
Match: SCAM4_ARATH (Secretory carrier-associated membrane protein 4 OS=Arabidopsis thaliana GN=SCAMP4 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 1.052e-12 Identity = 33/39 (84.62%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 340 RTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLT 456 RTDSALKF WFF YLIHIGFCI AAIAPP+ FHGKSLT Sbjct: 178 RTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLT 216
BLAST of EY659890 vs. ExPASy Swiss-Prot
Match: SCAM6_ORYSJ (Secretory carrier-associated membrane protein 6 OS=Oryza sativa subsp. japonica GN=SCAMP6 PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 3.060e-12 Identity = 32/39 (82.05%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 340 RTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLT 456 RT+SA F WFFL YLIHIGFCI AAIAPP+VFHGKSLT Sbjct: 187 RTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLT 225
BLAST of EY659890 vs. ExPASy Swiss-Prot
Match: SCAM3_ARATH (Secretory carrier-associated membrane protein 3 OS=Arabidopsis thaliana GN=SCAMP3 PE=1 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.220e-12 Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 340 RTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSL 453 RTDSAL F WFFLFY++HI FC+FAA+APPVVF GKSL Sbjct: 185 RTDSALSFGWFFLFYMLHIAFCVFAAVAPPVVFKGKSL 222
BLAST of EY659890 vs. ExPASy Swiss-Prot
Match: SCAM1_ARATH (Secretory carrier-associated membrane protein 1 OS=Arabidopsis thaliana GN=SCAMP1 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 1.519e-11 Identity = 29/39 (74.36%), Postives = 33/39 (84.62%), Query Frame = 1 Query: 340 RTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLT 456 RTDSALKF WFF YL HI FC+FAA+APP++F GKSLT Sbjct: 178 RTDSALKFGWFFFTYLFHIAFCVFAAVAPPIIFKGKSLT 216
BLAST of EY659890 vs. ExPASy Swiss-Prot
Match: SCAM5_ORYSJ (Secretory carrier-associated membrane protein 5 OS=Oryza sativa subsp. japonica GN=SCAMP5 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 2.591e-11 Identity = 29/39 (74.36%), Postives = 33/39 (84.62%), Query Frame = 1 Query: 340 RTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLT 456 RTDSA F WFFL Y++HI FC+FAAIAPPV+F GKSLT Sbjct: 195 RTDSAFSFGWFFLCYMLHIAFCVFAAIAPPVIFRGKSLT 233 The following BLAST results are available for this feature:
BLAST of EY659890 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY659890 ID=EY659890; Name=EY659890; organism=Citrus sinensis; type=EST; length=903bpback to top |