EY659682

Overview
NameEY659682
Unique NameEY659682
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length913
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig332 contig Csv1_Contig332:238..1151. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_BOVIN (Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.560e-66
Identity = 68/122 (55.74%), Postives = 86/122 (70.49%), Query Frame = 1
Query:    4 RVRLAKLSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            ++ +A L GH+G VW+VAWAHP +G+ILASCS+D  VIIWKE N   W K H    H SSVNS+ WAPH+ GL LACGSSDG IS+ T    G W+  +I+ AH +G  +VSWAP+  PG+L
Sbjct:   47 QILVADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGT-WEKTHEHTGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGLGQWEVKKINNAHTIGCNAVSWAPAVVPGSL 167          

HSP 2 Score: 108.612 bits (270), Expect = 1.560e-66
Identity = 51/97 (52.58%), Postives = 67/97 (69.07%), Query Frame = 2
Query:  395 VXKLCSGGCDNTVKVWKLY-NGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTV-AREGDQWEGKVLHDFKTPVYRVSWSLT 679
            + K  SGGCDN +K+WK   +G WK +    L+ H+DWVRDVAWAP++GLP STIAS S+DG+V +WT     G+ W  K+LH F   V+ VSWS+T
Sbjct:  179 IKKFASGGCDNLIKLWKEEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFVWTCDDASGNTWSPKLLHKFNDVVWHVSWSIT 273          

HSP 3 Score: 37.7354 bits (86), Expect = 1.560e-66
Identity = 15/29 (51.72%), Postives = 23/29 (79.31%), Query Frame = 1
Query:  682 NILAVADGNNNVTLWEKTMDGPWPQVTAV 768
            NILAV+ G+N VTLW++++DG W  ++ V
Sbjct:  275 NILAVSGGDNKVTLWKESVDGQWVCISDV 303          
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_HUMAN (Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=1 SV=3)

HSP 1 Score: 152.14 bits (383), Expect = 3.444e-66
Identity = 67/122 (54.92%), Postives = 87/122 (71.31%), Query Frame = 1
Query:    4 RVRLAKLSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            ++ +A L GH+G VW+VAWAHP +G+ILASCS+D  VIIW+E N   W K H    H SSVNS+ WAPH+ GL LACGSSDG IS+ T   +G W+  +I+ AH +G  +VSWAP+  PG+L
Sbjct:   47 QILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGT-WEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSL 167          

HSP 2 Score: 105.531 bits (262), Expect = 3.444e-66
Identity = 50/97 (51.55%), Postives = 66/97 (68.04%), Query Frame = 2
Query:  395 VXKLCSGGCDNTVKVWKLY-NGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTV-AREGDQWEGKVLHDFKTPVYRVSWSLT 679
            + +  SGGCDN +K+WK   +G WK +    L+ H+DWVRDVAWAP++GLP STIAS S+DG+V IWT      + W  K+LH F   V+ VSWS+T
Sbjct:  179 IKRFASGGCDNLIKLWKEEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSIT 273          

HSP 3 Score: 37.7354 bits (86), Expect = 3.444e-66
Identity = 15/29 (51.72%), Postives = 23/29 (79.31%), Query Frame = 1
Query:  682 NILAVADGNNNVTLWEKTMDGPWPQVTAV 768
            NILAV+ G+N VTLW++++DG W  ++ V
Sbjct:  275 NILAVSGGDNKVTLWKESVDGQWVCISDV 303          
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_RAT (Protein SEC13 homolog OS=Rattus norvegicus GN=Sec13 PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 2.256e-62
Identity = 68/122 (55.74%), Postives = 87/122 (71.31%), Query Frame = 1
Query:    4 RVRLAKLSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            ++ +A L GH+G VW+VAWAHP +G+ILASCS+D  VIIWKE N   W K H    H SSVNS+ WAPH+ GL LACGSSDG IS+ T   +G W+  +I+ AH +G  +VSWAP+  PG+L
Sbjct:   47 QILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGT-WEKTHEHSGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSL 167          

HSP 2 Score: 108.227 bits (269), Expect = 2.256e-62
Identity = 51/97 (52.58%), Postives = 67/97 (69.07%), Query Frame = 2
Query:  395 VXKLCSGGCDNTVKVWKLY-NGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTV-AREGDQWEGKVLHDFKTPVYRVSWSLT 679
            + K  SGGCDN +K+W+   +G WK +    L+ H+DWVRDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+LH F   V+ VSWS+T
Sbjct:  179 IKKFASGGCDNLIKLWREEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKLLHKFNDVVWHVSWSIT 273          
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_MOUSE (Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=2 SV=3)

HSP 1 Score: 153.295 bits (386), Expect = 2.256e-62
Identity = 68/122 (55.74%), Postives = 87/122 (71.31%), Query Frame = 1
Query:    4 RVRLAKLSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            ++ +A L GH+G VW+VAWAHP +G+ILASCS+D  VIIWKE N   W K H    H SSVNS+ WAPH+ GL LACGSSDG IS+ T   +G W+  +I+ AH +G  +VSWAP+  PG+L
Sbjct:   47 QILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGT-WEKTHEHSGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSL 167          

HSP 2 Score: 108.227 bits (269), Expect = 2.256e-62
Identity = 51/97 (52.58%), Postives = 67/97 (69.07%), Query Frame = 2
Query:  395 VXKLCSGGCDNTVKVWKLY-NGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTV-AREGDQWEGKVLHDFKTPVYRVSWSLT 679
            + K  SGGCDN +K+W+   +G WK +    L+ H+DWVRDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+LH F   V+ VSWS+T
Sbjct:  179 IKKFASGGCDNLIKLWREEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKLLHKFNDVVWHVSWSIT 273          
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_DICDI (Protein transport protein SEC13 OS=Dictyostelium discoideum GN=sec13 PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 7.973e-58
Identity = 61/119 (51.26%), Postives = 79/119 (66.39%), Query Frame = 1
Query:   13 LAKLSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            L  L GH+G VW+VAWAHPKFG ILAS S+D  VI+WKE  +N W   H +  H+ SVNSI WAPHE GL LAC SSDG++++     +  W+  +  Q   +GV SVSW+P+  P +L
Sbjct:   48 LVDLRGHEGPVWQVAWAHPKFGKILASASYDRKVIVWKEVGNNSWSIIHQYAGHELSVNSISWAPHEFGLSLACASSDGSVTIHNYN-NNVWEAPQKIQVSQIGVNSVSWSPAAIPTSL 165          

HSP 2 Score: 99.3673 bits (246), Expect = 7.973e-58
Identity = 48/97 (49.48%), Postives = 62/97 (63.92%), Query Frame = 2
Query:  392 PVXKLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTVAREGDQWEGKVLHDFKTPVYRVSWSLTG 682
            P+ ++ +G CDN +K++K     W +D    L+ H DWVRDVAWAPN+GLP S IAS S+D  VI+WT    G  W GK L  F   V+RVSWS+ G
Sbjct:  176 PIKRIVTGSCDNLIKIFKNVEDKWILD--KQLEDHKDWVRDVAWAPNIGLPYSKIASCSQDRSVIVWTQDENG-VWSGKPLPKFDDIVWRVSWSVIG 269          

HSP 3 Score: 34.2686 bits (77), Expect = 7.973e-58
Identity = 14/29 (48.28%), Postives = 21/29 (72.41%), Query Frame = 1
Query:  682 NILAVADGNNNVTLWEKTMDGPWPQVTAV 768
            NILAV+ G+N VTLW++ +D  W  ++ V
Sbjct:  270 NILAVSCGDNQVTLWKEGVDSEWKLISHV 298          
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_USTMA (Protein transport protein SEC13 OS=Ustilago maydis GN=SEC13 PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.273e-54
Identity = 71/148 (47.97%), Postives = 85/148 (57.43%), Query Frame = 1
Query:    1 PRVRLAKLSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKE-----------------------GNSNEW--IKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            P      L GH+G VW+VAWAHP FG ILASCS+DG V+IWK+                        ++  W  IK+H    H +SVNSI WAPHELG  LAC SSDGN+SV T   DG W    +  AHPVG  +VSWAP+  PG+L
Sbjct:   60 PSTTAETLHGHQGPVWQVAWAHPTFGDILASCSYDGKVVIWKDNGAGASIGASAPYGSQSAYGAPTSSAGGWTKIKEHTL--HTASVNSISWAPHELGSILACASSDGNVSVLTFNNDGTWAVDLV-AAHPVGCNAVSWAPAVVPGSL 204          

HSP 2 Score: 87.8113 bits (216), Expect = 1.273e-54
Identity = 46/109 (42.20%), Postives = 62/109 (56.88%), Query Frame = 2
Query:  395 VXKLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTVAREGDQWEGKVL-------------HDFKTPVYRVSWSLTG 682
            V +  S GCDNTVK+W+      +     ALQ H+DWVRDVA+APN+GLP+S +A+AS+D  V+IWT       W    L             + F   V+RVSWS++G
Sbjct:  225 VKRFASAGCDNTVKIWEFSQEANRFVEVEALQGHSDWVRDVAFAPNVGLPRSYLATASQDRTVLIWTQDSPTAAWSKTALNPISASAAAGAGSNKFPDTVWRVSWSVSG 333          

HSP 3 Score: 31.187 bits (69), Expect = 1.273e-54
Identity = 11/27 (40.74%), Postives = 19/27 (70.37%), Query Frame = 1
Query:  682 NILAVADGNNNVTLWEKTMDGPWPQVT 762
            N+LAV+ G+  +TLW++ + G W  V+
Sbjct:  334 NVLAVSCGDGKITLWKENLKGAWECVS 360          
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_CHAGB (Protein transport protein SEC13 OS=Chaetomium globosum GN=SEC13 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.652e-53
Identity = 63/116 (54.31%), Postives = 82/116 (70.69%), Query Frame = 1
Query:   22 LSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            L GH GAVW V+WAHPK+G+ILAS  +DG V+IW+E N   W + + F  HK+SVN + W+PHE G  LAC SSDGN+SV   + +  W+ S I  AH +GV SVSWAP+T PG++
Sbjct:   39 LKGHDGAVWCVSWAHPKYGNILASAGYDGKVLIWREQN-GAWQRIYDFSLHKASVNVVSWSPHEAGCVLACASSDGNVSVLEFKDNNSWEHS-IFHAHGLGVNSVSWAPATNPGSI 152          

HSP 2 Score: 80.8777 bits (198), Expect = 8.652e-53
Identity = 49/97 (50.52%), Postives = 60/97 (61.86%), Query Frame = 2
Query:  401 KLCSGGCDNTVKVWKL--YNGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTV-AREGDQWEGKVLHDFKTPVYRVSWSLTG 682
            +  +GG DN +K+W      G +K++  P L  HTDWVRDVAW+P + L KS IASASED  V IWT       QW  KVL  F   V+RVSWSL+G
Sbjct:  166 RFVTGGSDNALKIWAFDAATGAYKLEREP-LTGHTDWVRDVAWSPTV-LQKSYIASASEDRTVRIWTSDPANPQQWNCKVL-GFDAAVWRVSWSLSG 259          

HSP 3 Score: 33.8834 bits (76), Expect = 8.652e-53
Identity = 12/29 (41.38%), Postives = 20/29 (68.97%), Query Frame = 1
Query:  682 NILAVADGNNNVTLWEKTMDGPWPQVTAV 768
            N+LA + G+N VTLW++ + G W  V ++
Sbjct:  260 NVLAASGGDNKVTLWKENLKGEWECVKSI 288          
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_NEUCR (Protein transport protein sec-13 OS=Neurospora crassa GN=sec-13 PE=3 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 1.203e-51
Identity = 63/116 (54.31%), Postives = 80/116 (68.97%), Query Frame = 1
Query:   22 LSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            L GH GAVW VAWAHPK+G+ILAS  +DG V+IW+E  +  W +   F  HK+SVN + W+PHE G  LAC SSDGN+SV   + D  W+   I  AH +GV SVSWAP+T PG++
Sbjct:   54 LKGHDGAVWSVAWAHPKYGNILASAGYDGKVLIWRE-QAGSWQRIFDFALHKASVNIVSWSPHEAGCLLACASSDGNVSVLEFK-DNSWE-HNIFHAHGLGVNSVSWAPATTPGSI 166          

HSP 2 Score: 78.5666 bits (192), Expect = 1.203e-51
Identity = 49/98 (50.00%), Postives = 64/98 (65.31%), Query Frame = 2
Query:  401 KLCSGGCDNTVKVWKL---YNGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTV-AREGDQWEGKVLHDFKTPVYRVSWSLTG 682
            +  +GG DN +K+W      NG +K++  P L  HTDWVRDVAW+P + L KS IASAS+D  V IWT  A    +W+ KVL +F   V+RVSWSL+G
Sbjct:  180 RFVTGGSDNLLKIWTFDPATNG-YKLEREP-LAGHTDWVRDVAWSPTV-LQKSYIASASQDKTVRIWTSDAANPGEWKCKVL-NFDAAVWRVSWSLSG 273          

HSP 3 Score: 34.2686 bits (77), Expect = 1.203e-51
Identity = 12/29 (41.38%), Postives = 18/29 (62.07%), Query Frame = 1
Query:  682 NILAVADGNNNVTLWEKTMDGPWPQVTAV 768
            N+LA +  NN VTLW++ + G W  V  +
Sbjct:  274 NVLAASSDNNKVTLWKENLKGEWENVKTI 302          
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_ASPNC (Protein transport protein sec13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec13 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.594e-51
Identity = 68/124 (54.84%), Postives = 83/124 (66.94%), Query Frame = 1
Query:   22 LSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKEGNSN--------EWIKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            L GH+GAVW VAWAHPKFG+ILAS S+DG V+IW+E + N         W K   F  H +SVN + WAPHE G  LAC SSDG++SV   R D  W T +I  AH +GV S+SWAP+ APG+L
Sbjct:   52 LKGHEGAVWCVAWAHPKFGTILASSSYDGKVLIWREQHQNATSPVAGGAWTKVFDFSLHTASVNMVSWAPHESGCLLACASSDGHVSVLEFR-DNSW-THQIFHAHGMGVNSISWAPAAAPGSL 173          

HSP 2 Score: 73.559 bits (179), Expect = 7.594e-51
Identity = 42/95 (44.21%), Postives = 58/95 (61.05%), Query Frame = 2
Query:  401 KLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTV-AREGDQWEGKVLHDFKTPVYRVSWSLTG 682
            +  +GG DN +K+W         +    L+ H+DWVRDVAW+P++ L KS IASAS+D  V IWT  A    QW  + L +F T ++RVSWS +G
Sbjct:  185 RFVTGGSDNLLKIWDYNPETKTYNNTQTLEGHSDWVRDVAWSPSV-LSKSYIASASQDKTVRIWTSDASNPGQWTSQQL-EFDTVLWRVSWSPSG 277          

HSP 3 Score: 34.6538 bits (78), Expect = 7.594e-51
Identity = 13/26 (50.00%), Postives = 20/26 (76.92%), Query Frame = 1
Query:  682 NILAVADGNNNVTLWEKTMDGPWPQV 759
            NILAV+ G+N V+LW++ + G W +V
Sbjct:  278 NILAVSGGDNKVSLWKENLKGQWEKV 303          
BLAST of EY659682 vs. ExPASy Swiss-Prot
Match: SEC13_ASPCL (Protein transport protein sec13 OS=Aspergillus clavatus GN=sec13 PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 9.890e-51
Identity = 70/129 (54.26%), Postives = 87/129 (67.44%), Query Frame = 1
Query:   10 RLAK-LSGHKGAVWEVAWAHPKFGSILASCSFDGTVIIWKEGN--------SNEWIKDHVFEDHKSSVNSIDWAPHELGLCLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGAL 369
            RLA+ L GH+GAVW VAWAHPKFG+ILAS S+DG V+IW+E +         + W K   F  H +SVN + WAPHE G  LAC SSDG++SV   R D  W T +I  AH +GV S+SWAP+ APG+L
Sbjct:   34 RLAETLKGHEGAVWCVAWAHPKFGTILASSSYDGKVLIWREQHQSPTSPAAGSAWTKVFDFSLHTASVNMVSWAPHESGCLLACASSDGHVSVLEFR-DNSW-THQIFHAHGMGVNSISWAPAAAPGSL 160          

HSP 2 Score: 74.3294 bits (181), Expect = 9.890e-51
Identity = 42/95 (44.21%), Postives = 58/95 (61.05%), Query Frame = 2
Query:  401 KLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAPNLGLPKSTIASASEDGKVIIWTV-AREGDQWEGKVLHDFKTPVYRVSWSLTG 682
            +  +GG DN +K+W         +    L+ H+DWVRDVAW+P++ L KS IASAS+D  V IWT  A    QW  + L +F T ++RVSWS +G
Sbjct:  172 RFVTGGSDNLLKIWDYNPESKTYNITQTLEGHSDWVRDVAWSPSI-LSKSYIASASQDKTVRIWTSDASNPGQWTSQQL-EFDTVLWRVSWSPSG 264          

HSP 3 Score: 34.6538 bits (78), Expect = 9.890e-51
Identity = 13/26 (50.00%), Postives = 20/26 (76.92%), Query Frame = 1
Query:  682 NILAVADGNNNVTLWEKTMDGPWPQV 759
            NILAV+ G+N V+LW++ + G W +V
Sbjct:  265 NILAVSGGDNKVSLWKENLKGQWEKV 290          
The following BLAST results are available for this feature:
BLAST of EY659682 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
SEC13_BOVIN1.560e-6655.74Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 ... [more]
SEC13_HUMAN3.444e-6654.92Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=... [more]
SEC13_RAT2.256e-6255.74Protein SEC13 homolog OS=Rattus norvegicus GN=Sec1... [more]
SEC13_MOUSE2.256e-6255.74Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=... [more]
SEC13_DICDI7.973e-5851.26Protein transport protein SEC13 OS=Dictyostelium d... [more]
SEC13_USTMA1.273e-5447.97Protein transport protein SEC13 OS=Ustilago maydis... [more]
SEC13_CHAGB8.652e-5354.31Protein transport protein SEC13 OS=Chaetomium glob... [more]
SEC13_NEUCR1.203e-5154.31Protein transport protein sec-13 OS=Neurospora cra... [more]
SEC13_ASPNC7.594e-5154.84Protein transport protein sec13 OS=Aspergillus nig... [more]
SEC13_ASPCL9.890e-5154.26Protein transport protein sec13 OS=Aspergillus cla... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-H11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659682 ID=EY659682|Name=EY659682|organism=Citrus sinensis|type=EST|length=913bp
CCACGCGTCCGTCTCGCAAAGCTTAGTGGTCATAAAGGTGCTGTTTGGGA
GGTGGCTTGGGCTCACCCAAAATTTGGGTCTATACTTGCATCCTGTTCTT
TTGATGGGACTGTCATAATATGGAAGGAGGGTAACAGTAATGAGTGGATC
AAAGATCATGTTTTTGAGGACCACAAATCGTCAGTCAATTCGATTGATTG
GGCGCCTCATGAGCTCGGTCTATGTTTGGCTTGTGGTTCGTCAGATGGGA
ACATATCAGTTTTTACGGCTAGAGCTGATGGCGGCTGGGATACATCTCGG
ATTGACCAAGCTCATCCGGTTGGTGTGACTTCAGTTTCATGGGCCCCATC
AACAGCTCCCGGTGCACTTNGTGGGTTCTGGTTTTCTTGACCCAGTTCAN
AAGCTTTGTTCAGGTGGTTGTGATAATACCGTGAAGGTGTGGAAGCTGTA
CAATGGAATTTGGAAGATGGACTGCTTTCCAGCTCTTCAAATGCATACTG
ATTGGGTTAGAGATGTTGCTTGGGCTCCCAACTTGGGGCTTCCAAAATCT
ACTATTGCAAGTGCATCGGAGGATGGGAAAGTTATTATATGGACTGTGGC
CAGGGAAGGAGATCAATGGGAAGGTAAGGTGTTGCATGACTTCAAGACCC
CTGTTTATAGAGTCAGCTGGTCACTGACTGGAACATATTGGCTGTGGCTG
ATGGAAACAACAATGTAACACTGTGGGAAAAAACAATGGATGGGCCATGG
CCACAGGTGACTGCAGTTGGGCCGTAAGACTCTTTTAAGTTTTCAATTTT
TTATCATGAAATAACAGATTGCATTTAAGACCTCTTTATAATTTCTTTTT
GAGACCCTAAACCGGAATCCCACTCNTTTTATGTACTGCATAGCTGACAT
CTTTGATGAAAAT
back to top