EY659675

Overview
NameEY659675
Unique NameEY659675
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length810
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659675_ssr104 microsatellite EY659675_ssr104:104..117. BLAST: Citrus ESTs to Prunus persica proteins V1
EY659675_ssr123 microsatellite EY659675_ssr123:123..134. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9805 contig Csv1_Contig9805:8..817. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: PLT5_ARATH (Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2)

HSP 1 Score: 250.751 bits (639), Expect = 6.855e-66
Identity = 130/187 (69.52%), Postives = 144/187 (77.01%), Query Frame = 3
Query:  222 PQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGAISSVLLAVGV 782
            P K PKRN YA   AILASMTSILLGYDIGVMSGA +YIK DLK++D +I IL G LNIYSLIGS AAGRTSDWIGRRYTIV                 NYAFLM GRF+AGIGVGYALMIAPVYTAE+SPA++R  L SFPEVFIN GI+LGYV N     LPL +GWR+MLGIGA+ SV+LA+GV
Sbjct:   26 PAKPPKRNNYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKINDLQIGILAGSLNIYSLIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGLSPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLNSFPEVFINAGIMLGYVSNLAFSNLPLKVGWRLMLGIGAVPSVILAIGV 212          
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: PLT1_ARATH (Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 8.953e-66
Identity = 128/202 (63.37%), Postives = 156/202 (77.23%), Query Frame = 3
Query:  177 NNTDPQNQKTLADFDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGAISSVLLAVGV 782
            N++  +    +A+ +P +   R+ YA   AILASMTSI+LGYDIGVMSGA+++IKDDLK+SD ++EILMGILNIYSL+GS AAGRTSDW+GRRYTIV                TNY F+M GRFVAGIGVGYA+MIAPVYTAE++PA++R  LTSFPE+FIN GILLGYV NY   +LP HLGWR MLG+GA+ SV LA+GV
Sbjct:    2 NSSGVEQGVVIAESEPPRG-NRSRYAFACAILASMTSIILGYDIGVMSGASIFIKDDLKLSDVQLEILMGILNIYSLVGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYTAEVAPASSRGFLTSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFMLGVGAVPSVFLAIGV 202          
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: PLT2_ARATH (Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=2 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.293e-64
Identity = 127/192 (66.15%), Postives = 151/192 (78.65%), Query Frame = 3
Query:  207 LADFDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGAISSVLLAVGV 782
            +A+ +P +   R+ +A   AILASMTSI+LGYDIGVMSGAA++IKDDLK+SD ++EILMGILNIYSLIGS AAGRTSDWIGRRYTIV                TNY F+M GRFVAGIGVGYA+MIAPVYT E++PA++R  L+SFPE+FIN GILLGYV NY   +LP H+GWR MLGIGA+ SV LA+GV
Sbjct:   12 VAESEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGFFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHIGWRFMLGIGAVPSVFLAIGV 202          
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: PLT3_ARATH (Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 3.091e-50
Identity = 103/183 (56.28%), Postives = 131/183 (71.58%), Query Frame = 3
Query:  234 PKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGAISSVLLAVGV 782
            P  N +A G AI+AS+ SI+ GYD GVMSGA ++I+DDLK++DT+IE+L GILN+ +L+GSL AG+TSD IGRRYTI                  NY  LM GR +AG+GVG+ALMIAPVY+AE+S A+ R  LTS PE+ I+ GILLGYV NY   +L L LGWR+MLGI A  S++LA G+
Sbjct:   16 PHMNKFAFGCAIVASIISIIFGYDTGVMSGAQIFIRDDLKINDTQIEVLAGILNLCALVGSLTAGKTSDVIGRRYTIALSAVIFLVGSVLMGYGPNYPVLMVGRCIAGVGVGFALMIAPVYSAEISSASHRGFLTSLPELCISLGILLGYVSNYCFGKLTLKLGWRLMLGIAAFPSLILAFGI 198          
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: PLT6_ARATH (Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 6.446e-48
Identity = 99/193 (51.30%), Postives = 134/193 (69.43%), Query Frame = 3
Query:  207 LADFDPQKKPKR-NLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGAISSVLLAVGV 782
            +AD    +KP   N +A   AI+AS+ SI+ GYD GVMSGA ++I++DLK +D +IE+L GILN+ +L+GSL AGRTSD IGRRYTIV                 NY  L+ GR  AG+GVG+ALM+APVY+AE++ A+ R  L S P + I+ GILLGY+ NY   +LP+H+GWR+MLGI A+ S++LA G+
Sbjct:    1 MADQISGEKPAGVNRFALQCAIVASIVSIIFGYDTGVMSGAMVFIEEDLKTNDVQIEVLTGILNLCALVGSLLAGRTSDIIGRRYTIVLASILFMLGSILMGWGPNYPVLLSGRCTAGLGVGFALMVAPVYSAEIATASHRGLLASLPHLCISIGILLGYIVNYFFSKLPMHIGWRLMLGIAAVPSLVLAFGI 193          
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: PLT4_ARATH (Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 6.243e-43
Identity = 91/211 (43.13%), Postives = 129/211 (61.14%), Query Frame = 3
Query:  150 AAGLGTESNN----NTDPQNQKTLADFDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGAISSVLL 770
            A  +G + N     ++D +  +   + + +    R  Y    A  AS+ ++LLGYD+GVMSGA L+I+ DLK+++ + E+L+G L+I SL GSLA GRTSD IGR++T+                  ++  LM GR +AGIG+G  +MIAPVY AE+SP   R   TSFPE+FIN GILLGYV NY    L +H+ WR+ML +G + SV +
Sbjct:   18 AVSVGNKKNKYQRMDSDAEESQNHREAEARNSRTRK-YVMACAFFASLNNVLLGYDVGVMSGAVLFIQQDLKITEVQTEVLIGSLSIISLFGSLAGGRTSDSIGRKWTMALAALVFQTGAAVMAVAPSFEVLMIGRTLAGIGIGLGVMIAPVYIAEISPTVARGFFTSFPEIFINLGILLGYVSNYAFSGLSVHISWRIMLAVGILPSVFI 227          
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: INT1_ARATH (Probable inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.938e-21
Identity = 62/178 (34.83%), Postives = 91/178 (51.12%), Query Frame = 3
Query:  243 NLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKV---SDTKIEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGAISSVL 767
            N Y  G  + A +  +L GYD GV+SGA LYIKDD +V   S    E ++ +  + ++IG+ A G  +D+ GR+   +                 +   L+ GR + G+GVG A + APVY AE SP+  R  L S   + I GG  L Y+ N    Q+P    WR MLG+  + +V+
Sbjct:   28 NSYILGLTVTAGIGGLLFGYDTGVISGALLYIKDDFEVVKQSSFLQETIVSMALVGAMIGAAAGGWINDYYGRKKATLFADVVFAAGAIVMAAAPDPYVLISGRLLVGLGVGVASVTAPVYIAEASPSEVRGGLVSTNVLMITGGQFLSYLVNSAFTQVP--GTWRWMLGVSGVPAVI 203          
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: ITR2_SCHPO (Myo-inositol transporter 2 OS=Schizosaccharomyces pombe GN=itr2 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.146e-20
Identity = 63/198 (31.82%), Postives = 99/198 (50.00%), Query Frame = 3
Query:  168 ESNNNTDPQ-NQKTLADFDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLK--VSDTKIEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGA 752
            E  N TDPQ N+    + +  +  K + +    + +A ++ +L GYD GV+SGA   +  DL   +S  + E++    +  +LI +  +G  +DW+GR+  ++                 N A ++ GRF+ G G+G   +I P+Y  EL+PA  R  L     VFI GG L+ Y  N       +H GWR+M GIGA
Sbjct:   52 EEANATDPQANEVADENGEGFEAEKISSWIWVLSAVAGISGLLFGYDTGVISGALAVLGSDLGHVLSSGQKELITSATSFAALISATTSGWLADWVGRKRLLLCADAIFVIGSVIMAASRNVAMMVVGRFIVGYGIGLTSLIVPMYITELAPARLRGRLVIIYVVFITGGQLIAYSLNAAFEH--VHQGWRIMFGIGA 247          
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: GTR12_XENLA (Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.552e-20
Identity = 61/198 (30.81%), Postives = 104/198 (52.53%), Query Frame = 3
Query:  198 QKTLADFDPQKKPKRN---LYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGAISSVLLAVGV 782
            Q+  +D  PQ  P++     +   ++++A+++ +L+GY++G++SGA L ++  L+++  + EI++  L I +L+ SL  G   D  GRR TI+                 +Y  L+ GR   G+ +  + +   VY AELSP   R  L S  E+ I  GILL Y+ NY  L   ++ GW+ M G+    + L AV +
Sbjct:   13 QQRSSDDHPQTNPRQTGCGAFIILSSVIAAISGLLVGYELGIISGALLQLQSLLELTCQQQEIVVSALLIGALVASLVGGCLIDLYGRRTTIIFTSILLVFANLLPVVVVSYGSLIAGRIFIGVSISLSAIATCVYIAELSPQDKRGMLVSLNELMIVAGILLAYICNY--LFASVNNGWKYMFGLITPLAALQAVAM 208          
BLAST of EY659675 vs. ExPASy Swiss-Prot
Match: INT2_ARATH (Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.654e-19
Identity = 62/179 (34.64%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  240 RNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKI---EILMGILNIYSLIGSLAAGRTSDWIGRRYTIVXXXXXXXXXXXXXXXXTNYAFLMGGRFVAGIGVGYALMIAPVYTAELSPAATRSCLTSFPEVFINGGILLGYVWNYGXLQLPLHLGWRMMLGIGAISSVL 767
            +N Y    A  A +  +L GYD GV+SGA LYI+DD K  D      E+++ +    +++G+   G  +D +GRR  I+                 N + L+ GR   G+GVG A M AP+Y +E SPA  R  L S     I GG  L Y+ N     +     WR MLGI  I ++L
Sbjct:   24 KNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKSVDRNTWLQEMIVSMAVAGAIVGAAIGGWANDKLGRRSAILMADFLFLLGAIIMAAAPNPSLLVVGRVFVGLGVGMASMTAPLYISEASPAKIRGALVSTNGFLITGGQFLSYLINLAFTDVT--GTWRWMLGIAGIPALL 200          
The following BLAST results are available for this feature:
BLAST of EY659675 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
PLT5_ARATH6.855e-6669.52Polyol transporter 5 OS=Arabidopsis thaliana GN=PL... [more]
PLT1_ARATH8.953e-6663.37Putative polyol transporter 1 OS=Arabidopsis thali... [more]
PLT2_ARATH1.293e-6466.15Putative polyol transporter 2 OS=Arabidopsis thali... [more]
PLT3_ARATH3.091e-5056.28Probable polyol transporter 3 OS=Arabidopsis thali... [more]
PLT6_ARATH6.446e-4851.30Probable polyol transporter 6 OS=Arabidopsis thali... [more]
PLT4_ARATH6.243e-4343.13Probable polyol transporter 4 OS=Arabidopsis thali... [more]
INT1_ARATH3.938e-2134.83Probable inositol transporter 1 OS=Arabidopsis tha... [more]
ITR2_SCHPO1.146e-2031.82Myo-inositol transporter 2 OS=Schizosaccharomyces ... [more]
GTR12_XENLA2.552e-2030.81Solute carrier family 2, facilitated glucose trans... [more]
INT2_ARATH1.654e-1934.64Probable inositol transporter 2 OS=Arabidopsis tha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-H04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659675 ID=EY659675|Name=EY659675|organism=Citrus sinensis|type=EST|length=810bp
TACACTTCACACACAAGGCTTCTTGTTTTTGTAGTAGTTTCATGGCAGCT
TGAGTTTCTATCTCTTCTTCCAAACCCTAGCTTACATAATTAAACACTCG
CAGTCTCTCTCTCTCTCGCTCTCTAGCTAGCTAGCTTAGCAACAACATGG
CTGCAGGCTTGGGAACCGAGAGCAACAACAATACTGACCCTCAAAACCAA
AAAACTCTTGCGGATTTTGATCCCCAAAAGAAACCAAAAAGAAATCTGTA
TGCCTCCGGCGCTGCCATTTTGGCTTCCATGACTTCAATCTTACTAGGTT
ATGACATTGGAGTAATGAGTGGAGCTGCACTCTACATCAAAGACGACTTG
AAAGTCAGTGACACAAAAATCGAGATCTTAATGGGAATCTTGAATATTTA
CTCACTCATCGGCTCACTGGCTGCCGGCAGAACCTCCGACTGGATTGGCC
GCCGGTACACTATCGTGTTAGCCGGGGCCATCTTCTTCGCCGGAGCGCTG
CTCATGGGGTTCGCCACAAACTACGCTTTCCTCATGGGGGGTCGCTTCGT
CGCCGGTATCGGCGTCGGATACGCTCTCATGATCGCTCCCGTTTACACAG
CTGAACTTTCTCCGGCTGCTACTCGAAGCTGTCTCACCTCATTTCCTGAG
GTTTTCATTAACGGCGGGATATTACTGGGCTACGTCTGGAACTACGGATT
NCTGCAACTACCCCTNCACTTAGGCTGGCGCATGATGCTCGGAATCGGCG
CCATTTCGTCGGTGCTTCTCGCCGTCGGCGTGTAACCATGCCAGATCTCC
GCGCTGGCTG
back to top