EY659671

Overview
NameEY659671
Unique NameEY659671
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length809
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1972 contig Csv1_Contig1972:218..1026. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKIL5_ARATH (KH domain-containing protein At1g09660 OS=Arabidopsis thaliana GN=At1g09660 PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 1.241e-91
Identity = 163/232 (70.26%), Postives = 192/232 (82.76%), Query Frame = 3
Query:   21 KYLADLLAERQKLGPFVQVLPLCSRLLSQEIRRITGYNPSFVDHERFEHDSPFRSLGQPNGRPMDLEGLSAMQTEENGHLQRMAPFQTPPSMGWQGIPGIPTTPVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLNRTLTE 716
            +YL +LL ERQKLGPF+QV+P C RLL+ EIRR++    SF D +R+EH SPFRSLGQP    +DLEG S MQ EEN HLQR +PF+ P  +GW G+PG+P  P+VK+VIRLDVPVDKYP++NFVGRILGPRGNSLKRVE  T CRVFIRGRGSVKD++KEEKLK KPGYEHL EPLHVL+EAE PEDIIN RL+HAV  LE+LLKP+DES+DHYK++QL+ LA LN TL E
Sbjct:   44 RYLTELLQERQKLGPFLQVMPNCCRLLNHEIRRVS----SFPDLDRYEHGSPFRSLGQPTNGKLDLEGWSMMQAEENCHLQRASPFRGPSPVGWIGMPGLPNPPIVKKVIRLDVPVDKYPSYNFVGRILGPRGNSLKRVELATHCRVFIRGRGSVKDTVKEEKLKGKPGYEHLCEPLHVLIEAELPEDIINSRLEHAVHFLESLLKPMDESMDHYKREQLKELAALNGTLRE 271          
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKIL4_ARATH (KH domain-containing protein At3g08620 OS=Arabidopsis thaliana GN=At3g08620 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 6.200e-67
Identity = 136/239 (56.90%), Postives = 168/239 (70.29%), Query Frame = 3
Query:   21 KYLADLLAERQKLGPFVQVLPLCSRLLSQEIRRITGYNPS--FVDHERFEHDSPFRSLGQPNGRPM----DLEGLSAMQTEENGHLQRMAPFQTPPSMGWQGIPGIPTTPVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLNRTLTEH 719
            +Y++ LLAE QKLGPF+QVLP+CSRLL+QEI RITG  P+  F D +R  H SP   +  PN         L G + +  E  G    MA       M WQG P  P++  VKR++RLD+PVD YPNFNFVGR+LGPRGNSLKRVEA T CRV+IRG+GS+KD  KEEKLK KPGYEHLNE LH+L+EA+ P DI++ +L  A  I+E L+KPVDES D+ K+QQLR LA+LN  L E+
Sbjct:   30 QYISQLLAEHQKLGPFMQVLPICSRLLNQEIFRITGMMPNQGFTDFDRLRHRSP-SPMASPNLMSNVSGGGLGGWNGLPPERIGGPHGMA-------MEWQGAPASPSSYPVKRILRLDLPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLKGKPGYEHLNEQLHILIEADLPIDIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLREN 260          
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKIL3_ARATH (KH domain-containing protein At2g38610 OS=Arabidopsis thaliana GN=At2g38610 PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 6.416e-64
Identity = 127/229 (55.46%), Postives = 157/229 (68.56%), Query Frame = 3
Query:   21 KYLADLLAERQKLGPFVQVLPLCSRLLSQEIRRITGY--NPSFVDHERFEHDSPFRSLGQPNGRPMDLEGLSAMQTEENGHLQRMAPFQTPPSMGWQGIPGIPTTPVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLN 701
            +YL +LLAE QKL PF+QVLP+CSRLL+QE+ R++G   N  F D +R  H SP           +   GL       NG  Q         +M WQG PG P++  VKR++RL++PVD YPNFNFVGR+LGPRGNSLKRVEA T CRVFIRG+GS+KD  KE+KL+ +PGYEHLNE LH+L+EA+ P  I+  RL  A  I+E LLKPVDES D  K+QQLR LA+LN
Sbjct:   31 QYLTELLAEHQKLTPFMQVLPICSRLLNQEMFRVSGMMSNQGFGDFDRLRHRSPSPMASSNLMSNVSNTGLGGW----NGLSQERLSGTPGMTMDWQGAPGSPSSYTVKRILRLEIPVDNYPNFNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDPEKEDKLRGRPGYEHLNEQLHILIEADLPASIVEIRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLN 255          
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKIL1_ARATH (KH domain-containing protein At4g26475 OS=Arabidopsis thaliana GN=At4g26475 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.438e-63
Identity = 125/232 (53.88%), Postives = 160/232 (68.97%), Query Frame = 3
Query:   21 KYLADLLAERQKLGPFVQVLPLCSRLLSQEIRRITGYNPSFVDHERFEHDSPFRSLGQPNGRPMDLEGLSAMQTEENGHLQRMAPFQTPPSMGWQGIPGIPTTPVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLNRTLTE 716
            KYL++LLAER KL PF+ VLP   RL++QEI R+T    + +   RF+H SP  S G       D+ G ++    E           + P+  W   PG  +  +VKR IR+D+PVDKYPN+NFVGR+LGPRGNSLKRVEA T+CRV IRGRGS+KD IKE+ ++ KPGYEHLNEPLH+LVEAE P +I++ RL  A  IL++LL PV+E+ D YKKQQLR LA+LN +L E
Sbjct:   60 KYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENALSQSRFDHPSPLASGGIFQNSRADMNGWASQFPSERS-------VSSSPAPNWLNSPGSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMRGKPGYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLRE 284          
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKIL2_ARATH (KH domain-containing protein At5g56140 OS=Arabidopsis thaliana GN=At5g56140 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.282e-61
Identity = 127/234 (54.27%), Postives = 158/234 (67.52%), Query Frame = 3
Query:   21 KYLADLLAERQKLGPFVQVLPLCSRLLSQEIRRITGY--NPSFVDHERFEHDSPFRSLGQPNGRPMDLEGLSAMQTEENGHLQRMAPFQTPPSMGWQGIPGIPTTPVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLNRTLTE 716
            KYL++LLAER KL PF+ VLP   RLL+QEI R+T    N + +     +H SP  S G       D+ G ++    E     R  P  + P   W   PG  +  + KR IR+D+PVD YPNFNFVGR+LGPRGNSLKRVEA T+CRV IRGRGS+KD IKEE ++ KPGYEHLNEPLH+LVEAE P +I++ RL  A  IL++LL P++E+ D YKKQQLR LA+LN TL E
Sbjct:   64 KYLSELLAERHKLTPFLPVLPHAFRLLNQEILRVTTLLENATVLSQSGLDHPSPLASGGIFQNARADMNGWASQFPSE-----RSVP--SSPGPNWLNSPGSSSGLIAKRTIRVDIPVDNYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPMEETHDMYKKQQLRELALLNGTLRE 290          
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKI_RAT (Protein quaking OS=Rattus norvegicus GN=Qki PE=1 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.651e-27
Identity = 62/126 (49.21%), Postives = 86/126 (68.25%), Query Frame = 3
Query:  330 PVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLNRT 707
            P+V+   +L VPV +YP+FNFVGRILGPRG + K++EA T C++ +RG+GS++D  KEE+ + KP +EHLNE LHVL+  E  ++    +L  AV  ++ LL P  E  D  KK QL  LA+LN T
Sbjct:   78 PIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGT 203          
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKI_PIG (Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.651e-27
Identity = 62/126 (49.21%), Postives = 86/126 (68.25%), Query Frame = 3
Query:  330 PVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLNRT 707
            P+V+   +L VPV +YP+FNFVGRILGPRG + K++EA T C++ +RG+GS++D  KEE+ + KP +EHLNE LHVL+  E  ++    +L  AV  ++ LL P  E  D  KK QL  LA+LN T
Sbjct:   78 PIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGT 203          
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKI_MOUSE (Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.651e-27
Identity = 62/126 (49.21%), Postives = 86/126 (68.25%), Query Frame = 3
Query:  330 PVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLNRT 707
            P+V+   +L VPV +YP+FNFVGRILGPRG + K++EA T C++ +RG+GS++D  KEE+ + KP +EHLNE LHVL+  E  ++    +L  AV  ++ LL P  E  D  KK QL  LA+LN T
Sbjct:   78 PIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGT 203          
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKI_HUMAN (Protein quaking OS=Homo sapiens GN=QKI PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.651e-27
Identity = 62/126 (49.21%), Postives = 86/126 (68.25%), Query Frame = 3
Query:  330 PVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLNRT 707
            P+V+   +L VPV +YP+FNFVGRILGPRG + K++EA T C++ +RG+GS++D  KEE+ + KP +EHLNE LHVL+  E  ++    +L  AV  ++ LL P  E  D  KK QL  LA+LN T
Sbjct:   78 PIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGT 203          
BLAST of EY659671 vs. ExPASy Swiss-Prot
Match: QKI_HORSE (Protein quaking OS=Equus caballus GN=QKI PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.651e-27
Identity = 62/126 (49.21%), Postives = 86/126 (68.25%), Query Frame = 3
Query:  330 PVVKRVIRLDVPVDKYPNFNFVGRILGPRGNSLKRVEAMTECRVFIRGRGSVKDSIKEEKLKDKPGYEHLNEPLHVLVEAEFPEDIINXRLDHAVAILENLLKPVDESLDHYKKQQLRGLAMLNRT 707
            P+V+   +L VPV +YP+FNFVGRILGPRG + K++EA T C++ +RG+GS++D  KEE+ + KP +EHLNE LHVL+  E  ++    +L  AV  ++ LL P  E  D  KK QL  LA+LN T
Sbjct:   78 PIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGT 203          
The following BLAST results are available for this feature:
BLAST of EY659671 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
QKIL5_ARATH1.241e-9170.26KH domain-containing protein At1g09660 OS=Arabidop... [more]
QKIL4_ARATH6.200e-6756.90KH domain-containing protein At3g08620 OS=Arabidop... [more]
QKIL3_ARATH6.416e-6455.46KH domain-containing protein At2g38610 OS=Arabidop... [more]
QKIL1_ARATH2.438e-6353.88KH domain-containing protein At4g26475 OS=Arabidop... [more]
QKIL2_ARATH2.282e-6154.27KH domain-containing protein At5g56140 OS=Arabidop... [more]
QKI_RAT1.651e-2749.21Protein quaking OS=Rattus norvegicus GN=Qki PE=1 S... [more]
QKI_PIG1.651e-2749.21Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1[more]
QKI_MOUSE1.651e-2749.21Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1[more]
QKI_HUMAN1.651e-2749.21Protein quaking OS=Homo sapiens GN=QKI PE=1 SV=1[more]
QKI_HORSE1.651e-2749.21Protein quaking OS=Equus caballus GN=QKI PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659671 ID=EY659671|Name=EY659671|organism=Citrus sinensis|type=EST|length=809bp
CTTTGCCTTTTAGATCGTGAAAGTATTTGGCTGACTTATTGGCAGAAAGG
CAAAAGTTAGGACCATTTGTCCAAGTTTTGCCTCTATGCAGCAGGCTTCT
CAGTCAAGAAATCAGACGAATAACGGGTTACAATCCAAGTTTTGTTGATC
ATGAAAGGTTTGAGCATGATAGCCCATTTAGGTCATTAGGTCAGCCAAAT
GGAAGACCAATGGATTTGGAGGGTTTGTCTGCAATGCAAACTGAGGAAAA
TGGGCACCTTCAAAGAATGGCCCCTTTTCAAACTCCTCCTTCAATGGGCT
GGCAAGGTATTCCTGGAATTCCAACCACACCTGTTGTAAAGAGAGTTATT
AGACTTGATGTTCCTGTGGATAAATATCCAAATTTTAATTTTGTCGGCCG
GATTTTGGGACCGCGTGGGAACTCGCTCAAAAGAGTCGAAGCCATGACAG
AATGTAGGGTGTTCATTAGAGGCCGGGGTTCAGTCAAGGATTCAATAAAG
GAAGAAAAACTTAAAGATAAACCTGGATATGAGCATCTTAATGAGCCACT
GCACGTGTTAGTGGAGGCCGAATTTCCAGAGGATATAATAAATTNCCGCT
TGGATCATGCTGTAGCAATACTAGAGAACCTTTTGAAGCCCGTGGATGAA
TCCTTGGATCATTACAAGAAGCAACAACTGCGGGGATTAGCTATGCTGAA
CCGGACTCTAACAGAACACANCCAAGACTGAATCCGAGCCTGACTCCTAA
GCTGGGGGCCCTTAACCATGCTGGAAGAAACGCGGNCAGACCGGAACAAA
CATGNNATC
back to top