EY659664

Overview
NameEY659664
Unique NameEY659664
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length951
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLNA4_PHAVU (Glutamine synthetase leaf isozyme, chloroplastic OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 2.800e-112
Identity = 205/284 (72.18%), Postives = 222/284 (78.17%), Query Frame = 1
Query:    7 LMKQNKKGTTRSSAKFRVLALKSEDSTVNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYSSWSQW*ALMPEIILWGPRLPLERIPDQAGVVFSLVPNQL-GETECGWVPTNSGTRA 855
            LMKQNKK    SSAKFRVLA+KS+ ST+NRLE LLNLDITP+TDKIIAEYIWIGGTGID+RSKS+TISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRHRAAE+FSN +V AEVPWFGIEQEYTLLQ NV WPLGWPVG YPGPQGPYYC AGADKSF RDI+DAHYKACL+A                EY        +     +W  R  LERI +QAGVV SL P  + G+       TN  T++
Sbjct:   34 LMKQNKK---TSSAKFRVLAVKSDGSTINRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEVFSNPRVIAEVPWFGIEQEYTLLQTNVNWPLGWPVGGYPGPQGPYYCSAGADKSFGRDISDAHYKACLFAGINISGTNGEVMPGQWEYQVGPSV-GIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKS 313          
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLNA2_DAUCA (Glutamine synthetase, chloroplastic OS=Daucus carota GN=GLN2 PE=2 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 6.898e-111
Identity = 198/289 (68.51%), Postives = 225/289 (77.85%), Query Frame = 1
Query:   10 MKQNKKGTTRSSAKFRVLALKSEDSTVNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYSSWSQW*ALMPEI------ILWGPRLPLERIPDQAGVVFSLVPNQL-GETECGWVPTNSGTRA 855
            +KQNKK   RSS K+R LA+KSED T+NR+EDLLNLD+TPYTDKIIAEYIWIGGTGID+RSKS+TISKPVEHPSELPKWNYDGSSTGQAPG+DSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRH+AA+IFS++KV  EVPWFGIEQEYTL+QQ+V WPLGW VG YPGPQGPYYC AGADKSF RDI+DAHYKACLYA              PG++        + P +       +W  R  LERI +QAGVV +L P  + G+       TN  T++
Sbjct:   35 LKQNKKAPARSSTKYRALAVKSEDGTINRMEDLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPGDDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHKAAQIFSDAKVLGEVPWFGIEQEYTLMQQDVNWPLGWNVGGYPGPQGPYYCAAGADKSFGRDISDAHYKACLYA--GINISGTNGEVMPGQWEF-----QVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIDGDWNGAGCHTNYSTKS 316          
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLNA2_PEA (Glutamine synthetase leaf isozyme, chloroplastic OS=Pisum sativum GN=GS2 PE=2 SV=2)

HSP 1 Score: 396.356 bits (1017), Expect = 1.301e-109
Identity = 196/284 (69.01%), Postives = 219/284 (77.11%), Query Frame = 1
Query:    7 LMKQNKKGTTRSSAKFRVLALKSEDSTVNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYSSWSQW*ALMPEIILWGPRLPLERIPDQAGVVFSLVPNQL-GETECGWVPTNSGTRA 855
            +MKQ KK     SAKFRV+A+ SE+ T+NR+EDLLNLDITP+TD IIAEYIWIGGTGID+RSKS+TISKPV HPSE+PKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD YTPAGEPIPTNKRHRAAEIFSN KV AE+PW+GIEQEYTLLQ NVKWPLGWPVG YPGPQGPYYC AGADKSF RDI+DAHYKAC+YA                EY        +     +W  R  LERI +QAGVV +L P  + G+       TN  T++
Sbjct:   34 VMKQTKK--VAHSAKFRVMAVNSENGTINRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVSHPSEVPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVVCDAYTPAGEPIPTNKRHRAAEIFSNPKVEAEIPWYGIEQEYTLLQTNVKWPLGWPVGGYPGPQGPYYCAAGADKSFGRDISDAHYKACIYAGINISGTNGEVMPGQWEYQVGPSV-GIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKS 314          
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLNA2_MEDSA (Glutamine synthetase leaf isozyme, chloroplastic OS=Medicago sativa GN=GS2 PE=2 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 5.465e-108
Identity = 197/284 (69.37%), Postives = 218/284 (76.76%), Query Frame = 1
Query:    7 LMKQNKKGTTRSSAKFRVLALKSEDSTVNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYSSWSQW*ALMPEIILWGPRLPLERIPDQAGVVFSLVPNQL-GETECGWVPTNSGTRA 855
            +MKQNKK     SAKFRV+A+ S   T+NR+EDLLNLDITP+TD IIAEYIWIGGTGID+RSKS+TISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKRH+AAEIFSN KV AE+PW+GIEQEYTLLQ +VKWPLGWPVG YPGPQGPYYC AGADKSF RDI+DAHYKACLYA                EY        +     +W  R  LERI +QAGVV +L P  + G+       TN  T++
Sbjct:   34 VMKQNKK--VARSAKFRVMAINS--GTINRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVEAEIPWYGIEQEYTLLQTDVKWPLGWPVGGYPGPQGPYYCAAGADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSV-GIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKS 312          
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLNA2_ARATH (Glutamine synthetase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GLN2 PE=1 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 1.393e-103
Identity = 191/290 (65.86%), Postives = 221/290 (76.21%), Query Frame = 1
Query:    7 LMKQNKKGTTRSSAKFRVLALKSEDSTVNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYSSWSQW*ALMPEI------ILWGPRLPLERIPDQAGVVFSLVPNQL-GETECGWVPTNSGTRA 855
            ++KQ K+   +    FRVLAL+S++STVNR+E LLNLD  PY+D+IIAEYIWIGG+GID+RSKS+TI KPVE PSELPKWNYDGSSTGQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR +AAEIFSN KVS EVPWFGIEQEYTLLQQNVKWPLGWPVGA+PGPQGPYYCG GADK + RDI+DAHYKACLYA              PG++        + P +       +W  R  LERI +QAGVV +L P  + G+       TN  T++
Sbjct:   33 VLKQKKQSNNKVRG-FRVLALQSDNSTVNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRAKAAEIFSNKKVSGEVPWFGIEQEYTLLQQNVKWPLGWPVGAFPGPQGPYYCGVGADKIWGRDISDAHYKACLYA--GINISGTNGEVMPGQWEF-----QVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKS 314          
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLNAC_BRANA (Glutamine synthetase, chloroplastic OS=Brassica napus GN=GLN2 PE=2 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 6.914e-103
Identity = 186/290 (64.14%), Postives = 223/290 (76.90%), Query Frame = 1
Query:    7 LMKQNKKGTTRSSAKFRVLALKSEDSTVNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYSSWSQW*ALMPEI------ILWGPRLPLERIPDQAGVVFSLVPNQL-GETECGWVPTNSGTRA 855
            ++KQ K+ +++  + F+V+AL+S++ST+NR+E LLNLD  P+TD+IIAEYIWIGG+GID+RSKS+T+ KPVE PSELPKWNYDGSSTGQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR RAAEIFSN KV+ E+PWFGIEQEYTLLQ NV WPLGWPVGAYPGPQGPYYCG GA+KS+ RDI+DAHYKACLYA              PG++        + P +       +W  R  LERI +QAGVV +L P  + G+       TN  T++
Sbjct:   31 VLKQKKQSSSKVRS-FKVMALQSDNSTINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVNEEIPWFGIEQEYTLLQPNVNWPLGWPVGAYPGPQGPYYCGVGAEKSWGRDISDAHYKACLYA--GINISGTNGEVMPGQWEF-----QVGPSVGIEAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKS 312          
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLNA2_ORYSJ (Glutamine synthetase, chloroplastic OS=Oryza sativa subsp. japonica GN=GLN2 PE=1 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 7.155e-100
Identity = 180/277 (64.98%), Postives = 211/277 (76.17%), Query Frame = 1
Query:   31 TTRSSAKFRVLALKSEDS-TVNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYSSWSQW*ALMPEIILWGPRLPLERIPDQAGVVFSLVPNQL-GETECGWVPTNSGTRA 855
            T R ++ FRV+A+ +E +  V R+E LLN+D TP+TDKIIAEYIW+GGTGID+RSKS+TISKPVE PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKR+RAA++FS+ KV ++VPWFGIEQEYTLLQ++V WPLGWPVG YPGPQGPYYC  G+DKSF RDI+DAHYKACLYA                EY        +     +W  R  LERI +QAGVV +L P  + G+       TN  T++
Sbjct:   37 TGRGTSGFRVMAVSTETTGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPAGEPIPTNKRNRAAQVFSDPKVVSQVPWFGIEQEYTLLQRDVNWPLGWPVGGYPGPQGPYYCAVGSDKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSV-GIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKS 312          
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLNAC_MAIZE (Glutamine synthetase, chloroplastic OS=Zea mays GN=GLN2 PE=2 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 4.637e-99
Identity = 179/285 (62.81%), Postives = 209/285 (73.33%), Query Frame = 1
Query:    4 WLMKQNKKGTTRSSAKFRVLALKSEDS-TVNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYSSWSQW*ALMPEIILWGPRLPLERIPDQAGVVFSLVPNQL-GETECGWVPTNSGTR 852
            W   + + G   +S  F+V+A+ +  +  V RLE LLN+D TPYTDK+IAEYIW+GG+GID+RSKS+TISKPVE PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKRHRAA+IFS+ KV  +VPWFGIEQEYTLLQ++V WPLGWPVG +PGPQGPYYC  GADKSF RDI+DAHYKACLYA                EY        +     +W  R  LERI +QAGVV +L P  + G+       TN  T+
Sbjct:   23 WSAGRTRTGRGGASPGFKVMAVSTGSTGVVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRAAQIFSDPKVGEQVPWFGIEQEYTLLQKDVNWPLGWPVGGFPGPQGPYYCAVGADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSV-GIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTK 306          
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLNA2_HORVU (Glutamine synthetase leaf isozyme, chloroplastic OS=Hordeum vulgare PE=2 SV=2)

HSP 1 Score: 357.836 bits (917), Expect = 5.127e-98
Identity = 172/258 (66.67%), Postives = 202/258 (78.29%), Query Frame = 1
Query:   37 RSSAKFRVLALKSEDS-TVNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYSSWSQW*ALMPEIILWGPRLPLERIPDQAGVVFSLVPNQL 807
            R+++ F+VLAL  E +  + R++ LL++D TP+TDKIIAEYIW+GG+GID+RSKS+TISKPVE PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRH AA+IFS+ KV+++VPWFGIEQEYTL+Q++V WPLGWPVG YPGPQGPYYC  G+DKSF RDI+DAHYKACLYA                EY        +     +W  R  LERI +QAGVV +L P  +
Sbjct:   45 RATSGFKVLALGPETTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPKVTSQVPWFGIEQEYTLMQRDVNWPLGWPVGGYPGPQGPYYCAVGSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSV-GIDAGDHIWASRYILERITEQAGVVLTLDPKPI 301          
BLAST of EY659664 vs. ExPASy Swiss-Prot
Match: GLN11_ARATH (Glutamine synthetase cytosolic isozyme 1-1 OS=Arabidopsis thaliana GN=GLN1-1 PE=1 SV=2)

HSP 1 Score: 325.479 bits (833), Expect = 2.820e-88
Identity = 154/238 (64.71%), Postives = 183/238 (76.89%), Query Frame = 1
Query:   97 LEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPVGAYPGPQGPYYCGAGADKSFARDIADAHYKACLYAXXXXXXXXXXXXAWPGEYS-SWSQW*ALMPEIILWGPRLPLERIPDQAGVVFSLVPNQL 807
            + DL+NL+++  TDKIIAEYIW+GG+G+DMRSK++T+  PV  PS+LPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FSN  V+AEVPW+GIEQEYTLLQ++VKWP+GWP+G YPGPQGPYYCG GADKSF RD+ D+HYKACLYA              PG++         +     +W  R  LERI + AGVV S  P  +
Sbjct:    4 VSDLINLNLSDSTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSNPDVAAEVPWYGIEQEYTLLQKDVKWPVGWPIGGYPGPQGPYYCGIGADKSFGRDVVDSHYKACLYA--GINISGINGEVMPGQWEFQVGPAVGISAADEIWVARYILERITEIAGVVVSFDPKPI 239          
The following BLAST results are available for this feature:
BLAST of EY659664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
GLNA4_PHAVU2.800e-11272.18Glutamine synthetase leaf isozyme, chloroplastic O... [more]
GLNA2_DAUCA6.898e-11168.51Glutamine synthetase, chloroplastic OS=Daucus caro... [more]
GLNA2_PEA1.301e-10969.01Glutamine synthetase leaf isozyme, chloroplastic O... [more]
GLNA2_MEDSA5.465e-10869.37Glutamine synthetase leaf isozyme, chloroplastic O... [more]
GLNA2_ARATH1.393e-10365.86Glutamine synthetase, chloroplastic/mitochondrial ... [more]
GLNAC_BRANA6.914e-10364.14Glutamine synthetase, chloroplastic OS=Brassica na... [more]
GLNA2_ORYSJ7.155e-10064.98Glutamine synthetase, chloroplastic OS=Oryza sativ... [more]
GLNAC_MAIZE4.637e-9962.81Glutamine synthetase, chloroplastic OS=Zea mays GN... [more]
GLNA2_HORVU5.127e-9866.67Glutamine synthetase leaf isozyme, chloroplastic O... [more]
GLN11_ARATH2.820e-8864.71Glutamine synthetase cytosolic isozyme 1-1 OS=Arab... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-G03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659664 ID=EY659664|Name=EY659664|organism=Citrus sinensis|type=EST|length=951bp
CAATGGCTTATGAAGCAGAACAAGAAAGGAACAACTAGGAGTTCTGCCAA
GTTTAGAGTGCTTGCTTTGAAATCTGAAGACAGCACTGTCAATAGGCTAG
AGGATCTACTCAATTTGGACATCACTCCATATACTGACAAAATCATTGCC
GAATATATTTGGATTGGAGGTACTGGGATTGATATGCGTAGCAAGTCAAA
GACCATTTCAAAGCCTGTTGAGCATCCATCTGAGCTTCCCAAGTGGAATT
ATGATGGATCAAGTACTGGACAGGCACCTGGTGAAGATAGTGAAGTAATT
TTATACCCTCAAGCAATTTTTAAGGACCCCTTCCGTGGAGGAAACAACAT
CTTGGTAATTTGTGATACCTACACACCAGCAGGCGAGCCCATCCCTACAA
ACAAACGCCATAGGGCTGCTGAAATTTTCAGTAACTCGAAAGTGTCTGCT
GAAGTTCCATGGTTTGGGATAGAGCAAGAGTACACCTTACTTCAACAAAA
TGTGAAATGGCCTCTGGGTTGGCCTGTTGGAGCCTATCCTGGTCCCCAGG
GTCCTTATTACTGTGGAGCTGGGGCTGATAAGTCGTTTGCCCGTGACATT
GCAGATGCTCATTACAAAGCTTGCTTGTATGCTGGCATTAACATTATTGG
CACCAACCGGGGAGGTAATGCCTGGCCAGGGGAATATTCAAGTTGGTCCC
AGTGGTAGGCATTGATGCCGGAGATCATATTATGGGGTCCAAGATTACCT
CTTGAGAGAATCCCTGACCAAGCGGGTGTGGTTTTCTCACTGGTCCCAAA
CCAATTGGGGGAAACGGAATGTGGCTGGGTCCCCACCAATTCCGGNACAA
GAGCCCAAGGAGGGAGGAGGCTGTGAACTTTAAGAAGGCGTCTTGGATCC
GGCCTTTCCCTAAAGAAACATCATGGCTATAGGGAAAGAAAGTAGAAAGG
C
back to top