EY659662

Overview
NameEY659662
Unique NameEY659662
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length877
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: CYPR1_CYNCA (Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2)

HSP 1 Score: 241.121 bits (614), Expect = 4.901e-72
Identity = 111/142 (78.17%), Postives = 127/142 (89.44%), Query Frame = 2
Query:   26 CYFSIACYFHSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYVP 451
            CYFS+AC FHSKYRS  S+TYKKNGKSA I YGTG+ISGFFS+D VK+GDL+VK+Q+FIEAT+EP +TFL AKFDGILGLGFQEISVG AVPVWY M+NQGLV EPVFSFW NRNADE+  GE+V GG+DP+H+KGEHTYVP
Sbjct:   82 CYFSVACLFHSKYRSTDSTTYKKNGKSAAIQYGTGSISGFFSQDSVKLGDLLVKEQDFIEATKEPGITFLAAKFDGILGLGFQEISVGDAVPVWYTMLNQGLVQEPVFSFWLNRNADEQEGGELVFGGVDPNHFKGEHTYVP 223          

HSP 2 Score: 52.373 bits (124), Expect = 4.901e-72
Identity = 24/35 (68.57%), Postives = 26/35 (74.29%), Query Frame = 3
Query:  450 PVTQK*YWQFDMADVMIDWPTTGFCAGGFPAIGDS 554
            PVTQK YWQF+M DV+I   TTGFCA G  AI DS
Sbjct:  223 PVTQKGYWQFEMGDVLIGDKTTGFCASGCAAIADS 257          
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: ASPR_CUCPE (Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.086e-71
Identity = 109/142 (76.76%), Postives = 126/142 (88.73%), Query Frame = 2
Query:   26 CYFSIACYFHSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYVP 451
            C FS+AC+FH++Y+S RSS+YKKNG SA I YGTGA+SGFFS D+VK+GDLVVK+Q FIEATREPSLTFL+AKFDG+LGLGFQEI+VG AVPVWYNMV QGLV EPVFSFW NRN +EE  GEIV GG+DP HY+G+HTYVP
Sbjct:  120 CLFSVACHFHARYKSSRSSSYKKNGTSASIRYGTGAVSGFFSYDNVKVGDLVVKEQVFIEATREPSLTFLVAKFDGLLGLGFQEIAVGNAVPVWYNMVEQGLVKEPVFSFWLNRNVEEEEGGEIVFGGVDPKHYRGKHTYVP 261          

HSP 2 Score: 55.0694 bits (131), Expect = 1.086e-71
Identity = 25/35 (71.43%), Postives = 26/35 (74.29%), Query Frame = 3
Query:  450 PVTQK*YWQFDMADVMIDWPTTGFCAGGFPAIGDS 554
            PVTQK YWQFDM DV+ID   TGFC GG  AI DS
Sbjct:  261 PVTQKGYWQFDMGDVLIDGEPTGFCDGGCSAIADS 295          
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: ASPR1_ORYSJ (Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2)

HSP 1 Score: 239.965 bits (611), Expect = 1.848e-71
Identity = 112/142 (78.87%), Postives = 126/142 (88.73%), Query Frame = 2
Query:   26 CYFSIACYFHSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYVP 451
            CYFSIAC+FHS+Y+S +SSTY+KNGK A I YGTG+I+GFFSED V +GDLVVKDQEFIEAT+EP LTF++AKFDGILGLGFQEISVG AVPVWY MV QGLV+EPVFSFWFNR++DE   GEIV GGMDP HYKG HTYVP
Sbjct:  116 CYFSIACFFHSRYKSGQSSTYQKNGKPAAIQYGTGSIAGFFSEDSVTVGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGFQEISVGDAVPVWYKMVEQGLVSEPVFSFWFNRHSDEGEGGEIVFGGMDPSHYKGNHTYVP 257          

HSP 2 Score: 51.6026 bits (122), Expect = 1.848e-71
Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 3
Query:  450 PVTQK*YWQFDMADVMIDWPTTGFCAGGFPAIGDS 554
            PV+QK YWQF+M DV+I   TTGFCA G  AI DS
Sbjct:  257 PVSQKGYWQFEMGDVLIGGKTTGFCASGCSAIADS 291          
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: ASPR_HORVU (Phytepsin OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 2.016e-70
Identity = 107/142 (75.35%), Postives = 123/142 (86.62%), Query Frame = 2
Query:   26 CYFSIACYFHSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYVP 451
            CYFSIACY HS+Y++  SSTYKKNGK A I YGTG+I+G+FSED V +GDLVVKDQEFIEAT+EP +TFL+AKFDGILGLGF+EISVGKAVPVWY M+ QGLV++PVFSFW NR+ DE   GEI+ GGMDP HY GEHTYVP
Sbjct:  115 CYFSIACYLHSRYKAGASSTYKKNGKPAAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLGFKEISVGKAVPVWYKMIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYVGEHTYVP 256          

HSP 2 Score: 55.4546 bits (132), Expect = 2.016e-70
Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = 3
Query:  432 VSTHMF-PVTQK*YWQFDMADVMIDWPTTGFCAGGFPAIGDS 554
            V  H + PVTQK YWQFDM DV++   +TGFCAGG  AI DS
Sbjct:  249 VGEHTYVPVTQKGYWQFDMGDVLVGGKSTGFCAGGCAAIADS 290          
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: ASPRX_ORYSJ (Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2)

HSP 1 Score: 201.83 bits (512), Expect = 8.837e-59
Identity = 93/142 (65.49%), Postives = 116/142 (81.69%), Query Frame = 2
Query:   26 CYFSIACYFHSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYVP 451
            CYFSIACY HS+Y S +SS+YK +G++  I YG+GAISGFFS+D+V +GDLVVK+Q+FIEATRE S+TF++ KFDGILGLG+ EISVGKA P+W +M  Q L+ + VFSFW NR+ D    GE+V GGMDP HYKG+HTYVP
Sbjct:  108 CYFSIACYLHSRYNSKKSSSYKADGETCKITYGSGAISGFFSKDNVLVGDLVVKNQKFIEATRETSVTFIIGKFDGILGLGYPEISVGKAPPIWQSMQEQELLADDVFSFWLNRDPDASSGGELVFGGMDPKHYKGDHTYVP 249          

HSP 2 Score: 47.3654 bits (111), Expect = 8.837e-59
Identity = 21/35 (60.00%), Postives = 27/35 (77.14%), Query Frame = 3
Query:  450 PVTQK*YWQFDMADVMIDWPTTGFCAGGFPAIGDS 554
            PV++K YWQF+M D++ID  +TGFCA G  AI DS
Sbjct:  249 PVSRKGYWQFNMGDLLIDGHSTGFCAKGCAAIVDS 283          
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: CATD_DICDI (Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 5.923e-38
Identity = 75/142 (52.82%), Postives = 91/142 (64.08%), Query Frame = 2
Query:   38 IACYFHSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYVPCHTE 463
            +AC  H+KY S  SSTY  NG    I YG+GA+SGF S+D V +G L VKDQ F EAT EP + F  AKFDGILGL FQ ISV    PV+YNM++QGLV+  +FSFW +R       GE+  G +D   Y G+ TYVP   E
Sbjct:   99 VACDLHNKYNSGASSTYVANGTDFTIQYGSGAMSGFVSQDSVTVGSLTVKDQLFAEATAEPGIAFDFAKFDGILGLAFQSISVNSIPPVFYNMLSQGLVSSTLFSFWLSRTPGAN-GGELSFGSIDNTKYTGDITYVPLTNE 239          

HSP 2 Score: 33.8834 bits (76), Expect = 5.923e-38
Identity = 16/35 (45.71%), Postives = 20/35 (57.14%), Query Frame = 3
Query:  450 PVTQK*YWQFDMADVMIDWPTTGFCAGGFPAIGDS 554
            P+T + YW+F M D  ID  + GFC     AI DS
Sbjct:  235 PLTNETYWEFVMDDFAIDGQSAGFCGTTCHAICDS 269          
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: CARDF_CYNCA (Cardosin-F (Fragments) OS=Cynara cardunculus PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.316e-37
Identity = 75/133 (56.39%), Postives = 85/133 (63.91%), Query Frame = 2
Query:   53 HSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYVP 451
            HS Y S  SSTYK                   S+D V IGDLVVK+Q+FIEAT E    FL   FDGILGL FQ IS    VPVWYNM+NQGLV    FSFW NRN DEE  GE+V GG+DP+H++G+HTYVP
Sbjct:   50 HSMYESSGSSTYK-------------------SQDSVTIGDLVVKEQDFIEATEEADNVFLNRLFDGILGLSFQTIS----VPVWYNMLNQGLVKR--FSFWLNRNVDEEEGGELVFGGLDPNHFRGDHTYVP 157          

HSP 2 Score: 41.9726 bits (97), Expect = 1.316e-37
Identity = 19/35 (54.29%), Postives = 23/35 (65.71%), Query Frame = 3
Query:  450 PVTQK*YWQFDMADVMIDWPTTGFCAGGFPAIGDS 554
            PVT + YWQF + DV+I   +TGFCA G  A  DS
Sbjct:  157 PVTYQYYWQFGIGDVLIGDKSTGFCAPGCQAFADS 191          
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: CARP_NEUCR (Vacuolar protease A OS=Neurospora crassa GN=pep-4 PE=3 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 6.441e-36
Identity = 74/139 (53.24%), Postives = 95/139 (68.35%), Query Frame = 2
Query:   35 SIACYFHSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYVP 451
            SIACY H+KY S  SSTYKKNG S  I YG+G++SGF S+D + IGD+ + DQ F EAT EP L F   +FDGILGLG+  I+V    P +Y MV Q LV+EPVFSF+    AD++   E+V GG++ D Y G+ T +P
Sbjct:  118 SIACYLHNKYESSESSTYKKNGTSFKIEYGSGSLSGFVSQDRMTIGDITINDQLFAEATSEPGLAFAFGRFDGILGLGYDRIAVNGITPPFYKMVEQKLVDEPVFSFYL---ADQDGESEVVFGGVNKDRYTGKITTIP 253          
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: CARP_ASPFU (Vacuolar protease A OS=Aspergillus fumigatus GN=pep2 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.874e-35
Identity = 74/139 (53.24%), Postives = 94/139 (67.63%), Query Frame = 2
Query:   35 SIACYFHSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYVP 451
            SIAC+ H+KY S  SSTYK NG    I YG+G +SGF S+D ++IGDL V  Q+F EAT EP L F   +FDGILGLG+  ISV K VP +YNM++QGL++EPVF+F+      E    E   GG+D +HY GE T +P
Sbjct:  118 SIACFLHNKYDSSASSTYKANGTEFAIKYGSGELSGFVSQDTLQIGDLKVVKQDFAEATNEPGLAFAFGRFDGILGLGYDTISVNKIVPPFYNMLDQGLLDEPVFAFYLGDTNKEGDNSEASFGGVDKNHYTGELTKIP 256          
BLAST of EY659662 vs. ExPASy Swiss-Prot
Match: ASPP_AEDAE (Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 4.175e-35
Identity = 71/140 (50.71%), Postives = 96/140 (68.57%), Query Frame = 2
Query:   29 YFSIACYFHSKYRSCRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEE**GEIVSGGMDPDHYKGEHTYV 448
            + +IAC  H+KY + +SST++KNG +  I YG+G++SG+ S D V +G + V  Q F EA  EP L F+ AKFDGILGLG+  ISV   VPV+YNM NQGL++ PVFSF+ NR+      GEI+ GG D + Y G+ TY+
Sbjct:  101 FTNIACLMHNKYNAKKSSTFEKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILGLGYSSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNKYTGDFTYL 240          
The following BLAST results are available for this feature:
BLAST of EY659662 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
CYPR1_CYNCA4.901e-7278.17Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO... [more]
ASPR_CUCPE1.086e-7176.76Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1[more]
ASPR1_ORYSJ1.848e-7178.87Aspartic proteinase oryzasin-1 OS=Oryza sativa sub... [more]
ASPR_HORVU2.016e-7075.35Phytepsin OS=Hordeum vulgare PE=1 SV=1[more]
ASPRX_ORYSJ8.837e-5965.49Aspartic proteinase OS=Oryza sativa subsp. japonic... [more]
CATD_DICDI5.923e-3852.82Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE... [more]
CARDF_CYNCA1.316e-3756.39Cardosin-F (Fragments) OS=Cynara cardunculus PE=1 ... [more]
CARP_NEUCR6.441e-3653.24Vacuolar protease A OS=Neurospora crassa GN=pep-4 ... [more]
CARP_ASPFU1.874e-3553.24Vacuolar protease A OS=Aspergillus fumigatus GN=pe... [more]
ASPP_AEDAE4.175e-3550.71Lysosomal aspartic protease OS=Aedes aegypti GN=AA... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-G01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659662 ID=EY659662|Name=EY659662|organism=Citrus sinensis|type=EST|length=877bp
CAAATTTGTGGGTGCCCTCTTCTAATGTTATTTCTCGATTGCATGCTATT
TCCATTCCAAGTACAGGTCATGCCGCTCAAGTACCTACAAGAAGAATGGT
AAATCGGCTGATATCCATTATGGAACTGGAGCTATTTCTGGTTTTTTTAG
TGAAGACCATGTCAAAATCGGTGATCTTGTGGTCAAAGATCAGGAATTTA
TTGAGGCAACTAGGGAGCCCAGCCTCACTTTCTTGCTGGCCAAGTTTGAT
GGCATACTTGGACTTGGCTTCCAAGAGATTTCTGTTGGAAAGGCTGTGCC
CGTGTGGTACAATATGGTAAATCAAGGCCTTGTCAATGAACCAGTTTTCT
CCTTTTGGTTTAACCGAAATGCTGATGAGGAATAATGAGGTGAAATTGTT
TCTGGTGGGATGGACCCTGACCATTACAAGGGTGAGCACACATATGTTCC
CTGTCACACAGAAATGATATTGGCAGTTTGATATGGCTGATGTCATGATT
GATTGGCCAACAACAGGATTTTGCGCTGGCGGCTTTCCCGCAATTGGTGA
TTCAGAACCTTTTTGTTGGTGGTCCTACGACCTGATAACTTAAGCAACCT
GCCATTGGGGCGCCTGTATTGCCACTTAATAATGACAGTCTTTTTTTGAC
AGTTTGAGAAGGGACATCTCCCAATGCTCTTGCCAAGAGTGAGACCTCAG
AATTGGCCCCAAATTGGGTGGGCCCCTTTCTTGGGCTCCCAGCTCGAGTT
GTGCCCTTAAAGTGCTACCTGGAAAAACACTCACCTGTGTGGGGCTCCGT
ACACGCGGGCCCTCTTTTAGCTCAACCTGGGTGGATGCTAATCCCTGTAA
GGCATCAAACCGCGCTCGTGTTATGTA
back to top