EY659661

Overview
NameEY659661
Unique NameEY659661
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length775
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659661_ssr38 microsatellite EY659661_ssr38:38..49. BLAST: Citrus ESTs to Prunus persica proteins V1
EY659661_ssr647 microsatellite EY659661_ssr647:647..662. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7491 contig Csv1_Contig7491:1..775. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659661 vs. ExPASy Swiss-Prot
Match: COPT1_ARATH (Copper transporter 1 OS=Arabidopsis thaliana GN=COPT1 PE=2 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 3.300e-30
Identity = 64/123 (52.03%), Postives = 83/123 (67.48%), Query Frame = 2
Query:  209 FFWGKNSEILFSGWPGTSSGMYXXXXXXXXXXXXXXXXXSHCKLMKP---DANHVAAGLIQTLLHAIRVGLAFLVMLAIMSFNGGVFLVAVAGHTFGFFIFGSRVFNKSSPPPKTSDLPPMSC 568
            FFWGKN+E+LFSGWPGTSSGMY                 +H  L++    D+ + AAGLIQT ++ +R+GLA+LVMLA+MSFN GVFLVA+AGH  GF +FGS+ F  +S   KT+ +PP  C
Sbjct:   46 FFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGC 168          
The following BLAST results are available for this feature:
BLAST of EY659661 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
COPT1_ARATH3.300e-3052.03Copper transporter 1 OS=Arabidopsis thaliana GN=CO... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-F12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659661 ID=EY659661|Name=EY659661|organism=Citrus sinensis|type=EST|length=775bp
CGGACGCGTGGNGTTACCTCAAAGCACCGAAGGAAACAAAGAAAGAAAGA
AACTTTCAATAAAAGACTCCCAAGAGAGATCAGCAAACATTAGCAAAGCC
ATGGATGGCATGCATCATGATCATGGAAGCATGTCACCGCCCATGTCAAT
GAACAACACCAATAACACAGGGACGATGATGCATCATCACAACATGATGC
ACATGACGTTTTTCTGGGGCAAGAACTCTGAAATTCTCTTCTCAGGCTGG
CCTGGAACAAGCTCAGGAATGTATGCCTTAGCTTTGATTGTTGTGTTTGT
GTTGGCTGTGTTGGTTGAGTGGCTCTCTCACTGCAAATTGATGAAGCCTG
ATGCAAATCATGTGGCTGCTGGTTTGATTCAGACTCTTTTACATGCAATC
AGGGTTGGGCTTGCTTTCTTGGTGATGCTTGCTATTATGTCCTTTAATGG
AGGTGTGTTTTTGGTGGCTGTTGCTGGTCATACTTTTGGATTCTTTATTT
TTGGCAGCAGGGTTTTTAATAAATCATCACCCCCTCCAAAAACCTCTGAT
CTTCCTCCCATGAGTTGTTGATATAATTAATAGCTGATTACTAAGAGTTA
AGTATGTTCTTGAGTTTGGCTTTGTAGTTTATCTTGTAACTCTTAATTTC
TTTCTTTCTTTCTTCTCTCTGAAACTATCTGTAGAAACTGAATATGAAGA
AATGGTATTGTGGGGTGAGGAAAAAAAACAAAAAATACCGCCCACGCGAC
GCGCTTACTTACAAAAAAAAAAAAG
back to top