EY659656

Overview
NameEY659656
Unique NameEY659656
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length923
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659656_ssr88 microsatellite EY659656_ssr88:88..97. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: APRR2_ARATH (Two-component response regulator-like APRR2 OS=Arabidopsis thaliana GN=APRR2 PE=2 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 1.698e-50
Identity = 105/158 (66.46%), Postives = 124/158 (78.48%), Query Frame = 3
Query:  213 MVCTANDLSAWKDFPKGLRVLLL------DQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDGSFKFLETAKD-LPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHKAFNAGGSALSDSLKPVK 665
            MV TANDLS W++FPKGL+VLLL      D D S+AAE + +LE+MDYIV+TF +E EALSA    PE+FH+AIVEV  S    SFKFLE AKD LPTI+ S  HC++T MKCIALGAVEFL+KPLS +KL+N+WQHVVHKAFN GGS +S SLKPVK
Sbjct:    1 MVITANDLSKWENFPKGLKVLLLLNGCDSDGDGSSAAETRSELESMDYIVTTFTDETEALSAVVKNPESFHIAIVEVNMSAESESFKFLEAAKDVLPTIMISTDHCITTTMKCIALGAVEFLQKPLSPEKLKNIWQHVVHKAFNDGGSNVSISLKPVK 158          
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: ARR12_ARATH (Two-component response regulator ARR12 OS=Arabidopsis thaliana GN=ARR12 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.835e-12
Identity = 46/134 (34.33%), Postives = 68/134 (50.75%), Query Frame = 3
Query:  231 DLSAWKDFPKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDGSFKFLETA---KDLPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHKAFN 623
            +L A   FP G+RVL +D D +    L+  L    Y V+T     +AL    +    F + I +V   + DG FK LE      DLP I+ S       +MK +  GA ++L KP+  ++L+N+WQHVV   F+
Sbjct:    6 NLEALDQFPVGMRVLAVDDDQTCLKILESLLRHCQYHVTTTNQAQKALELLRENKNKFDLVISDVDMPDMDG-FKLLELVGLEMDLPVIMLSAHSDPKYVMKGVTHGACDYLLKPVRIEELKNIWQHVVRSRFD 138          
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: ARR1_ARATH (Two-component response regulator ARR1 OS=Arabidopsis thaliana GN=ARR1 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 4.088e-12
Identity = 46/124 (37.10%), Postives = 64/124 (51.61%), Query Frame = 3
Query:  252 FPKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDGSFKFLETA---KDLPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHK 614
            FP GLRVL++D D +    L+  L    Y V+       ALS        F + I +V   + DG FK LE      DLP I+ S     S ++K +  GAV++L KP+  + L+N+WQHVV K
Sbjct:   33 FPSGLRVLVVDDDPTCLMILERMLRTCLYEVTKCNRAEMALSLLRKNKHGFDIVISDVHMPDMDG-FKLLEHVGLEMDLPVIMMSADDSKSVVLKGVTHGAVDYLIKPVRMEALKNIWQHVVRK 155          
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: EHD1_ORYSJ (Two-component response regulator EHD1 OS=Oryza sativa subsp. japonica GN=EHD1 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.339e-12
Identity = 41/123 (33.33%), Postives = 66/123 (53.66%), Query Frame = 3
Query:  252 FPKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDGSFKFLETAKD--LPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHK 614
            +P GLRVL++D D S  + ++  L    Y V+T+ N  EA+    D P+   + I +      DG     E      +PT+I ++    +T+MK +A GA +FL KP+  ++L N+WQH+  K
Sbjct:    7 WPYGLRVLVIDDDCSYLSVMEDLLLKCSYKVTTYKNVREAVPFILDNPQIVDLVISDAFFPTEDGLLILQEVTSKFGIPTVIMASSGDTNTVMKYVANGAFDFLLKPVRIEELSNIWQHIFRK 129          
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: EHD1_ORYSI (Two-component response regulator EHD1 OS=Oryza sativa subsp. indica PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.339e-12
Identity = 41/123 (33.33%), Postives = 66/123 (53.66%), Query Frame = 3
Query:  252 FPKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDGSFKFLETAKD--LPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHK 614
            +P GLRVL++D D S  + ++  L    Y V+T+ N  EA+    D P+   + I +      DG     E      +PT+I ++    +T+MK +A GA +FL KP+  ++L N+WQH+  K
Sbjct:    7 WPYGLRVLVIDDDCSYLSVMEDLLLKCSYKVTTYKNVREAVPFILDNPQIVDLVISDAFFPTEDGLLILQEVTSKFGIPTVIMASSGDTNTVMKYVANGAFDFLLKPVRIEELSNIWQHIFRK 129          
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: PRR73_ORYSJ (Two-component response regulator-like PRR73 OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.973e-12
Identity = 44/148 (29.73%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  243 WKDF--PKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDG-----SFKFLETAKDLPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHKAFNAGGSALSDSLKPVK 665
            W+ F   K LRVLL++ D S    +   L    Y V    N   A     D   +  + + EV      G          +  KD+P I+ S+   + T+ KC++ GAV+FL KP+ +++L+NLWQHV  +  ++ GS     ++  K
Sbjct:   72 WERFLPVKTLRVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCLEDLQNHIDLVLTEVVMPRLSGIGLLSKITSHKICKDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGIRTQK 219          
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: PRR73_ORYSI (Two-component response regulator-like PRR73 OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 6.973e-12
Identity = 44/148 (29.73%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  243 WKDF--PKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDG-----SFKFLETAKDLPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHKAFNAGGSALSDSLKPVK 665
            W+ F   K LRVLL++ D S    +   L    Y V    N   A     D   +  + + EV      G          +  KD+P I+ S+   + T+ KC++ GAV+FL KP+ +++L+NLWQHV  +  ++ GS     ++  K
Sbjct:   72 WERFLPVKTLRVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCLEDLQNHIDLVLTEVVMPRLSGIGLLSKITSHKICKDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGIRTQK 219          
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: PRR37_ORYSJ (Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.973e-12
Identity = 45/161 (27.95%), Postives = 75/161 (46.58%), Query Frame = 3
Query:  204 KPAMVCTANDLSAWKDF--PKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDGSFKFLET-----AKDLPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHKAFNAGGSALSDSLKPVK 665
            +P  VC       W+ F   K ++VLL+D D S    +   L    Y V    N  +A +   D   +  + + EV      G             K++P I+ S+   + T+ KC++ GAV+FL KP+ +++L+NLWQHV  +  ++ GS     ++  K
Sbjct:   47 RPPQVC-------WERFIQKKTIKVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLEDMQNSIDLVLTEVVMPGVSGISLLSRIMNHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGIQTQK 200          
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: PRR37_ORYSI (Two-component response regulator-like PRR37 OS=Oryza sativa subsp. indica GN=PRR37 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 6.973e-12
Identity = 45/161 (27.95%), Postives = 75/161 (46.58%), Query Frame = 3
Query:  204 KPAMVCTANDLSAWKDF--PKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDGSFKFLET-----AKDLPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHKAFNAGGSALSDSLKPVK 665
            +P  VC       W+ F   K ++VLL+D D S    +   L    Y V    N  +A +   D   +  + + EV      G             K++P I+ S+   + T+ KC++ GAV+FL KP+ +++L+NLWQHV  +  ++ GS     ++  K
Sbjct:   47 RPPQVC-------WERFIQKKTIKVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLEDMQNSIDLVLTEVVMPGVSGISLLSRIMNHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGIQTQK 200          
BLAST of EY659656 vs. ExPASy Swiss-Prot
Match: ARR10_ARATH (Two-component response regulator ARR10 OS=Arabidopsis thaliana GN=ARR10 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.973e-12
Identity = 44/132 (33.33%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  231 DLSAWKDFPKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENEALSAFSDKPENFHVAIVEVTTSNTDGSFKFLETA---KDLPTIITSNIHCLSTMMKCIALGAVEFLRKPLSEDKLRNLWQHVVHKA 617
            ++     FP G+RVL +D D +    L+  L+   Y V+T      AL    +    F + I +V   + DG FK LE      DLP I+ S       +MK +  GA ++L KP+  ++L+N+WQHVV K+
Sbjct:    6 EIEVLDQFPVGMRVLAVDDDQTCLRILQTLLQRCQYHVTTTNQAQTALELLRENKNKFDLVISDVDMPDMDG-FKLLELVGLEMDLPVIMLSAHSDPKYVMKGVKHGACDYLLKPVRIEELKNIWQHVVRKS 136          
The following BLAST results are available for this feature:
BLAST of EY659656 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
APRR2_ARATH1.698e-5066.46Two-component response regulator-like APRR2 OS=Ara... [more]
ARR12_ARATH1.835e-1234.33Two-component response regulator ARR12 OS=Arabidop... [more]
ARR1_ARATH4.088e-1237.10Two-component response regulator ARR1 OS=Arabidops... [more]
EHD1_ORYSJ5.339e-1233.33Two-component response regulator EHD1 OS=Oryza sat... [more]
EHD1_ORYSI5.339e-1233.33Two-component response regulator EHD1 OS=Oryza sat... [more]
PRR73_ORYSJ6.973e-1229.73Two-component response regulator-like PRR73 OS=Ory... [more]
PRR73_ORYSI6.973e-1229.73Two-component response regulator-like PRR73 OS=Ory... [more]
PRR37_ORYSJ6.973e-1227.95Two-component response regulator-like PRR37 OS=Ory... [more]
PRR37_ORYSI6.973e-1227.95Two-component response regulator-like PRR37 OS=Ory... [more]
ARR10_ARATH6.973e-1233.33Two-component response regulator ARR10 OS=Arabidop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-F05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659656 ID=EY659656|Name=EY659656|organism=Citrus sinensis|type=EST|length=923bp
TGCAGCTAAAGAGCAAGTGAGAGAAACCTCTTGAGGAAAATACAAGAGCT
TTTCAAGCTTCACCAAACTCAAGAAGGAAAAGAAAAAATATATATATTAA
ACTCTTGTGTACACTTAGCTCATTGTTGCATGTACCAATTGATTTGGATG
ATGATCATAAGCAGTGATCTGCAACAATTGTTTGTGGCCTGAGAAAGGAT
GCCAAACCAGCTATGGTTTGCACTGCTAATGATTTATCAGCATGGAAGGA
TTTTCCAAAGGGCCTCAGGGTCCTCTTACTTGATCAGGACAGCAGTGCGG
CTGCCGAGTTAAAATTCAAGCTTGAAGCTATGGACTACATTGTTTCCACA
TTCTACAATGAGAATGAAGCTCTGTCAGCATTTTCGGACAAACCTGAGAA
CTTCCATGTTGCCATTGTAGAGGTAACCACAAGCAACACTGATGGAAGTT
TTAAGTTTCTTGAAACTGCAAAGGATTTGCCTACTATTATAACTTCAAAT
ATTCATTGCTTGAGCACCATGATGAAGTGCATAGCGCTAGGTGCAGTTGA
ATTCCTCCGGAAACCACTTTCAGAGGATAAACTCAGGAACTTATGGCAGC
ATGTGGTTCATAAGGCATTCAATGCTGGGGGAAGCGCCCTCTCTGATTCA
CTAAAGCCTGTGAAAGAATCCGTGGTTTCCATGCTGCATCTTTAATTGGA
AATGGAGATNCAAGAACGAGAAAGTCGAGATACAGATATGTTTTGGTGCC
TCACAGAGTGACAATGACAGTCAGTACAAATGATAAAATCCTGCTGCCTC
ACTCCCACATTGAACAGGGGAGACGATTACTGAGACATAGATTGCCAGAT
ATACTACTTCTCACTGAAAAGAAAGTGCGGAGCAGATGGAGATCAAATTC
TCGAACTACTTGGGCATTTCATT
back to top