EY659653

Overview
NameEY659653
Unique NameEY659653
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length998
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659653 vs. ExPASy Swiss-Prot
Match: YC20L_ARATH (Ycf20-like protein OS=Arabidopsis thaliana GN=At1g65420 PE=2 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 2.724e-38
Identity = 86/131 (65.65%), Postives = 94/131 (71.76%), Query Frame = 3
Query:  264 KRHGWKIAFALDTGG-ISGSGGQ-ESLNGDGPDLGGTRLGRIVSAGGRQLLEKLNIARKNLPMKIFLLLLGFYTANALATILGQTGDWDXXXXXXXXXXIEGIGMLMYKKPPSS--TGEAASFWVMMNXWK 644
            +R   KIAFALDTG  I G  G+ + +NGD   LG TRLGRI  AGG+QLL K+N ARKN PMKIFLLLLGFYTANALATILGQTGDWD          IEGIGMLMYKKP SS  +G+  SF V MN WK
Sbjct:   51 RRPNRKIAFALDTGSSIPGDSGEGQEMNGDRTGLGSTRLGRIAIAGGKQLLGKINSARKNFPMKIFLLLLGFYTANALATILGQTGDWDVLVAGIVVAAIEGIGMLMYKKPSSSMFSGKLQSFVVFMNFWK 181          

HSP 2 Score: 25.409 bits (54), Expect = 2.724e-38
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 2
Query:  641 EAGVCFSLFVDAF 679
            +AGVC  LFVDAF
Sbjct:  181 KAGVCLGLFVDAF 193          
The following BLAST results are available for this feature:
BLAST of EY659653 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
YC20L_ARATH2.724e-3865.65Ycf20-like protein OS=Arabidopsis thaliana GN=At1g... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-F02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659653 ID=EY659653|Name=EY659653|organism=Citrus sinensis|type=EST|length=998bp
GTNCTTGTNCCGGNATTCCCGGCCCGACCCACGCGTCCGATTGACTTCTA
TTTCATTGTATTGGTTTCCTAAGTTTATATGCTTGTAGCTGGCGTCAAAT
GGGAGCACTGCCATTGCACTCAAGTTTGTTGATACTAGAGAGAGATGTCT
TTGAAAGTTCTTATATAAGGCTTGCAGTTAGTGCAAACCAGAAGTGGAAA
AATGAACCTAGTACAAGTGGACAGACTTCAAAGATCGGTTCAAAGTCTGC
TTGTTTTCTCGGAAAGAGACATGGCTGGAAAATAGCATTTGCGTTGGACA
CAGGTGGAATATCTGGGAGTGGTGGACAAGAGAGCCTCAATGGTGATGGT
CCTGATCTTGGTGGCACTAGATTGGGAAGGATAGTTAGTGCAGGTGGTAG
ACAGCTACTGGAGAAGCTGAACATAGCGAGAAAGAACCTTCCAATGAAGA
TATTTCTCCTGCTATTGGGTTTCTACACAGCAAATGCTCTAGCTACGATC
CTTGGACAGACAGGTGACTGGGATGTACTGGTTGCAGGTGTTGTAGTTGC
TGCCATTGAAGGTATAGGTATGCTTATGTACAAAAAGCCACCGTCGTCAA
CTGGGGAGGCTGCATCCTTTTGGGTGATGATGAACNTATGGAAGCCGGTG
TGTGCTTTAGCCTCTTTGTGGATGCTTTTAACTGGGAAGTTAATTAGCCT
ACCATTAGAAGAGTANGAGAATGTGCCGGTATCGACAGGATCAATCTGAG
CCCCACCACTGTTGGCTCATACACGACATGGCATACTACAATTGGCGCCC
TAACATTCCAGGGAACCACCTGGGTTAAACAATTCCTTCATCCCAAAAGC
CTATTTATCATTTTGGAATCCTGGGAATGCCATTTAGCTTTACACCAATT
GGAAAGGCCAATCTTCTAAATTAATTTGGCATTAAATGTTTGGCCATCCG
GGGTTCCCAGGGATTTCCCTTAAAATCAATTTTTACACTGGCGACTGG
back to top