EY659652

Overview
NameEY659652
Unique NameEY659652
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER42_ARATH (Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=1 SV=2)

HSP 1 Score: 303.908 bits (777), Expect = 8.118e-82
Identity = 143/164 (87.20%), Postives = 154/164 (93.90%), Query Frame = 1
Query:   16 PIHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLANKLH 507
            P HN+S+SVVLE+F +IGID PGLVALLGSHSVGRTHCVKLVHRLYPEVDP+LNPDHVPHMLHKCPD+IPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGL++VDHQLA DKRTRP VKKMAK Q YFFKEF+RAI +LSENNPLTG+KGEIRK CNLANK H
Sbjct:  167 PDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHRLYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLLLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLANKNH 330          
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER21_ARATH (Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 5.132e-52
Identity = 95/163 (58.28%), Postives = 119/163 (73.01%), Query Frame = 1
Query:   10 LSPIHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 498
            L P HNDS+S V+  F +IGID    VALLG+HSVGR HCV LVHRLYP +DP L+P +  ++  +CP   PDP AV Y RNDR TPMV+DN YY+NI+ +KGL+++D +LATD RT P+V KMA   +YF ++FSR + LLSE NPLTG +GEIRK C   N
Sbjct:  165 LIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCVNLVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAVLYSRNDRETPMVVDNMYYKNIMAHKGLLVIDDELATDPRTAPFVAKMAADNNYFHEQFSRGVRLLSETNPLTGDQGEIRKDCRYVN 327          
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER63_ARATH (Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.902e-22
Identity = 57/163 (34.97%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   10 LSPIHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 498
            L P+ +  +S ++++F++ G     +VAL G+H++G +HC +  +R+ P      NP     +   C ++  DP    +  ND  TP   DN Y++NI    GL+  DH L +D RTRP+V+  A+ Q  FF +F+ A+  LS +  LTG +GEIR+ C+  N
Sbjct:  168 LLPLPSMQISKLIDQFSSRGFSVQEMVALSGAHTIGFSHCKEFTNRVNPNNSTGYNPRFAVALKKACSNSKNDPTISVF--NDVMTPNKFDNMYFQNIPKGLGLLESDHGLFSDPRTRPFVELYARDQSRFFNDFAGAMQKLSLHGVLTGRRGEIRRRCDAIN 328          
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER12_ARATH (Peroxidase 12 OS=Arabidopsis thaliana GN=PER12 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 7.992e-21
Identity = 57/154 (37.01%), Postives = 79/154 (51.30%), Query Frame = 1
Query:   37 SVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 498
            S ++  FA   ++   LVAL G H++G  HC     RLYP  DP +N      +   CP A      V    ND  +P V DN YY ++++ +GL   D  L  DKRTR  V+  A  Q  FF  F+ A+  + + + LTGT+GEIR  C+  N
Sbjct:  190 SQLIADFANRNLNITDLVALSGGHTIGIAHCPSFTDRLYPNQDPTMNQFFANSLKRTCPTANSSNTQV----NDIRSPDVFDNKYYVDLMNRQGLFTSDQDLFVDKRTRGIVESFAIDQQLFFDYFTVAMIKMGQMSVLTGTQGEIRSNCSARN 339          
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER31_ARATH (Peroxidase 31 OS=Arabidopsis thaliana GN=PER31 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.363e-20
Identity = 59/163 (36.20%), Postives = 90/163 (55.21%), Query Frame = 1
Query:   10 LSPIHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 498
            L P+ +  +S ++++F + G     +VAL G+HS+G +HC + V R+    +   NP     +   C +   DP    +  ND  TP   DN YY+N+    GL+  DH L +D RTR +V   AK+QD FFK+F++A+  LS     TG +GEIR+ C+  N
Sbjct:  157 LLPLPSTPISKIIQQFESKGFTVQEMVALSGAHSIGFSHCKEFVGRVGRN-NTGYNPRFAVALKKACANYPKDPTISVF--NDIMTPNKFDNMYYQNLKKGLGLLESDHGLYSDPRTRYFVDLYAKNQDLFFKDFAKAMQKLSLFGIQTGRRGEIRRRCDAIN 316          
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER36_ARATH (Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 8.836e-20
Identity = 58/171 (33.92%), Postives = 88/171 (51.46%), Query Frame = 1
Query:   16 PIHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEV-----DPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDK-RTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLANKLHD 510
            P    ++  +L  F   G+D   LVALLGSH++G + C+    RLY        D  LN D+   +   CP +  D         D  TP   DN YY+N+++ +GL+  D  L T    T   VK  A+++  FF++F++++  +   +PLTGT GEIR++C   N  HD
Sbjct:  178 PSPESTLQTILTMFNFQGLDLTDLVALLGSHTIGNSRCIGFRQRLYNHTGNNDPDQTLNQDYASMLQQGCPISGNDQNLFNL---DYVTPTKFDNYYYKNLVNFRGLLSSDEILFTQSIETMEMVKYYAENEGAFFEQFAKSMVKMGNISPLTGTDGEIRRICRRVN--HD 343          
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER15_ARATH (Peroxidase 15 OS=Arabidopsis thaliana GN=PER15 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.154e-19
Identity = 53/167 (31.74%), Postives = 93/167 (55.69%), Query Frame = 1
Query:   16 PIHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEV-----DPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQL-ATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 498
            P  N++ + ++ RF   G+D   +VAL GSH++G + C     RLY +      D  L   +  ++  +CP +  D    +   N  G     DN+Y++N+++N GL+  D  L ++++++R  VKK A+ Q+ FF++F+ ++  +   +PLTG+ GEIRK C   N
Sbjct:  173 PAPNNTFNTIVTRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDRTLEQSYAANLRQRCPRSGGDQNLSELDINSAGR---FDNSYFKNLIENMGLLNSDEVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKIN 336          
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER72_ARATH (Peroxidase 72 OS=Arabidopsis thaliana GN=PER72 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.571e-19
Identity = 53/167 (31.74%), Postives = 92/167 (55.09%), Query Frame = 1
Query:   16 PIHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEV-----DPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLAT-DKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 498
            P  N++   +L +F   G+D   LV+L GSH++G + C     RLY +      D  L+  +   +  +CP +  D         D  TP   DN+Y++N++  KGL+  D  L T +K+++  V+  A++Q+ FF++F++++  +   +PLTG KGEIR++C   N
Sbjct:  170 PAPNNTFQTILTKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDMTLSQYYATLLRQRCPRSGGDQTLFFL---DFATPFKFDNHYFKNLIMYKGLLSSDEILFTKNKQSKELVELYAENQEAFFEQFAKSMVKMGNISPLTGAKGEIRRICRRVN 333          
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER41_ARATH (Peroxidase 41 OS=Arabidopsis thaliana GN=PER41 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.571e-19
Identity = 55/164 (33.54%), Postives = 86/164 (52.44%), Query Frame = 1
Query:   16 PIHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLANKLH 507
            P+ N S+  +L  F   G     LVAL G H++G +HC +  +R++P+VDP LN      +   C +   +     ++  D  TP   DN Y++N+    GL+  DH L  D  TRP+V+  A +Q  FF++F+RA+  L          GE+R+ C+  NKL+
Sbjct:  164 PLANQSVPDMLSIFKKNGFTLKELVALSGGHTIGFSHCKEFSNRIFPKVDPELNAKFAGVLKDLCKNFETNKTMAAFL--DPVTPGKFDNMYFKNLKRGLGLLASDHILFKDPSTRPFVELYANNQTAFFEDFARAMEKLGRVGVKGEKDGEVRRRCDHFNKLN 325          
BLAST of EY659652 vs. ExPASy Swiss-Prot
Match: PER6_ARATH (Peroxidase 6 OS=Arabidopsis thaliana GN=PER6 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 4.385e-19
Identity = 52/162 (32.10%), Postives = 86/162 (53.09%), Query Frame = 1
Query:   25 NDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDP----ALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 498
            N +M  ++  F + G+    +VAL+G+H++G +HC +   R++ + D      +NP +   +   C +   D +   +  ND  TP   DN YY+N+    GL+  DH +A D RTR  V   A+ +  FF  F++A+  +SE N  TG  GE+R+ C+  N
Sbjct:  163 NMTMDHIISIFESSGLTVQEMVALVGAHTIGFSHCKEFASRIFNKSDQNGPVEMNPKYAAELRKLCANYTNDEQMSAF--NDVFTPGKFDNMYYKNLKHGYGLLQSDHAIAFDNRTRSLVDLYAEDETAFFDAFAKAMEKVSEKNVKTGKLGEVRRRCDQYN 322          
The following BLAST results are available for this feature:
BLAST of EY659652 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
PER42_ARATH8.118e-8287.20Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=... [more]
PER21_ARATH5.132e-5258.28Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=... [more]
PER63_ARATH1.902e-2234.97Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=... [more]
PER12_ARATH7.992e-2137.01Peroxidase 12 OS=Arabidopsis thaliana GN=PER12 PE=... [more]
PER31_ARATH1.363e-2036.20Peroxidase 31 OS=Arabidopsis thaliana GN=PER31 PE=... [more]
PER36_ARATH8.836e-2033.92Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=... [more]
PER15_ARATH1.154e-1931.74Peroxidase 15 OS=Arabidopsis thaliana GN=PER15 PE=... [more]
PER72_ARATH2.571e-1931.74Peroxidase 72 OS=Arabidopsis thaliana GN=PER72 PE=... [more]
PER41_ARATH2.571e-1933.54Peroxidase 41 OS=Arabidopsis thaliana GN=PER41 PE=... [more]
PER6_ARATH4.385e-1932.10Peroxidase 6 OS=Arabidopsis thaliana GN=PER6 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-F01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659652 ID=EY659652|Name=EY659652|organism=Citrus sinensis|type=EST|length=901bp
ACTTGAGCATTATCTCCCATACACAATGACAGCATGTCTGTTGTTCTTGA
GAGGTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAG
GATCTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTG
TACCCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCT
CCATAAGTGTCCTGATGCAATCCCAGACCCCAAGGCTGTTCAGTATGTGA
GGAATGACCGTGGCACACCCATGGTGCTGGACAACAACTACTATAGGAAC
ATATTGGACAACAAGGGCTTGATGATGGTTGATCATCAGCTAGCCACCGA
CAAGAGGACAAGACCTTATGTTAAGAAGATGGCCAAGAGTCAAGACTACT
TCTTCAAGGAATTTTCAAGAGCCATTACTCTCCTTTCTGAGAACAACCCT
CTCACAGGTACAAAGGGTGAGATCCGAAAGGTTTGCAATCTTGCCAACAA
GCTCCACGACAAGTCCTAGCTAGCTAACAGCTGTATTAGCTACAACAAGT
TAATAGCTCCAAATTTTTCTTCCTTGTTTCTTCTATGAGGAAGAAAAGAG
TGTGAGATGAGCTCCCAATAAGATGGGTTTTCTAGATCGGGTTGTTTCCT
GTGAGATGTTCGGATTACTGCTATTATGTTTCCTAAATGTACCGGCCATG
TTTAAGCCTTAGCTTTCCTTTTCCTCGATGGGGTGAGCCTGATGTTATAA
TATTCCATAATGGCACGGGTAAATGAGGGATGTATGTTGTTTTCACGGGA
TGGGGATGGGGCCATGGATTNGCTAAGGTGATATTGGGGGATTCTGCCAA
AAAAATAAATAATAAAAAAAGGCGGGCGTTTAAAAGTTCAAATTTACTAC
C
back to top