EY659650

Overview
NameEY659650
Unique NameEY659650
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AATC_DAUCA (Aspartate aminotransferase, cytoplasmic OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 4.313e-96
Identity = 178/303 (58.75%), Postives = 211/303 (69.64%), Query Frame = 1
Query:   88 SAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHYYQHTVYLSQPTYGNHPNFFAAAGLAMKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIVTAYLKE 858
            S F  V RA + PI  V  A+ +D SP KLNLG G YRTEEGKPL+LN V++AEQ+LVND S  KEYLPI GL +FNKLSAKLIFGADSPAI+ENRV+TVQCLSG+GSLR+G +FLA+HY++HTVY+ QPT+GNHP  F  AGL++KTY YY+P+T GLDF+GML+DLG+AP  AIVLL A  HNPTG+DPT +QWEQIRQLMR K LLPFFD AY                                               VCKT D A +VES  +L+IRPMYS+PP+HGASIV A LK+
Sbjct:    3 SVFANVVRAPEDPILGVTVAYHKDQSPNKLNLGVGAYRTEEGKPLVLNVVKKAEQMLVNDQSRVKEYLPIVGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHYHEHTVYIPQPTWGNHPKIFTLAGLSVKTYRYYNPETRGLDFEGMLEDLGSAPLGAIVLLHACAHNPTGVDPTIEQWEQIRQLMRSKSLLPFFDSAYQGFASGSLDADAQSVRIFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASKVESQLKLVIRPMYSSPPLHGASIVAAILKD 305          
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AATC_ORYSJ (Aspartate aminotransferase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os01g0760600 PE=2 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 2.796e-95
Identity = 175/303 (57.76%), Postives = 211/303 (69.64%), Query Frame = 1
Query:   88 SAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHYYQHTVYLSQPTYGNHPNFFAAAGLAMKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIVTAYLKE 858
            S F  +A+A + PI  V  A+ +DPSP+K+NLG G YRTEEGKPL+LN VR+AEQ+L+N+ S  KEYLPITGL +FNKLSAKLIFGADSPAI+ENRV+TVQCLSG+GSLR+G +FLA+HY++ T+Y+ QPT+GNHP  F  AGL +++Y YYDP T GLDFQG+L+DLG+APS AIVLL A  HNPTG+DPT  QWEQIRQLMR K LLPFFD AY                                               VC + D A+RVES  +L+IRPMYSNPPIHGASIV   LK+
Sbjct:    5 SVFAGLAQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQMLINNPSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHYHERTIYIPQPTWGNHPKVFTLAGLTVRSYRYYDPATRGLDFQGLLEDLGSAPSGAIVLLHACAHNPTGVDPTLDQWEQIRQLMRSKALLPFFDSAYQGFASGSLDQDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVESQLKLVIRPMYSNPPIHGASIVATILKD 307          
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AAT3_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP3 PE=1 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 2.617e-93
Identity = 175/331 (52.87%), Postives = 216/331 (65.26%), Query Frame = 1
Query:    4 LSNYRSLSSSAYKMESKNSEKAKESDGDSAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHYYQHTVYLSQPTYGNHPNFFAAAGLAMKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIVTAYLKE 858
            L  + +  S +  + S  +       G S F  + +A + PI  V  A+ +DPSP+KLNLG G YRTEEGKPL+LN VR+AEQ L+ND +  KEYLPI GL EFNKLSAKLI GADSPAI+ENR++TV+CLSG+GSLR+G +FLAKHY+Q T+Y++QPT+GNHP  F  AGL +KTY YYDP T GL+FQG+L+DLGAA   +IVLL A  HNPTG+DPT QQWEQIR+LMR K L+PFFD AY                                               VCK+ D A RVES  +L+IRPMYS+PPIHGASIV   L++
Sbjct:   19 LLRHLNSGSDSDNLSSLYASPTSGGTGGSVFSHLVQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQQLINDRTRIKEYLPIVGLVEFNKLSAKLILGADSPAIRENRITTVECLSGTGSLRVGGEFLAKHYHQKTIYITQPTWGNHPKIFTLAGLTVKTYRYYDPATRGLNFQGLLEDLGAAAPGSIVLLHACAHNPTGVDPTIQQWEQIRKLMRSKGLMPFFDSAYQGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVESQLKLVIRPMYSSPPIHGASIVAVILRD 349          
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AAT2_ARATH (Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana GN=ASP2 PE=1 SV=2)

HSP 1 Score: 335.495 bits (859), Expect = 2.449e-91
Identity = 170/303 (56.11%), Postives = 206/303 (67.99%), Query Frame = 1
Query:   85 DSAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHYYQHTVYLSQPTYGNHPNFFAAAGLAMKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIVTAYLK 855
            DS F  VARA + PI  V  A+  DPSP+K+NLG G YRTEEGKPL+L+ VR+AEQ LVND S  KEY+PI G+ +FNKLSAKLI GADSPAI E+RV+TVQCLSG+GSLR+GA+FL  HY+Q  +Y+ +PT+GNHP  F  AGL+++ + YYDP T GLDF+G+L+DLGAAPS AIVLL A  HNPTG+DPT++QWEQIRQLMR K LLPFFD AY                                               VCK+ D A +VES  +L++RPMYS+PPIHGASIV   LK
Sbjct:    2 DSVFSNVARAPEDPILGVTVAYNNDPSPVKINLGVGAYRTEEGKPLVLDVVRKAEQQLVNDPSRVKEYIPIVGISDFNKLSAKLILGADSPAITESRVTTVQCLSGTGSLRVGAEFLKTHYHQSVIYIPKPTWGNHPKVFNLAGLSVEYFRYYDPATRGLDFKGLLEDLGAAPSGAIVLLHACAHNPTGVDPTSEQWEQIRQLMRSKSLLPFFDSAYQGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPPIHGASIVATILK 304          
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AAT1_MEDSA (Aspartate aminotransferase 1 OS=Medicago sativa GN=AAT-1 PE=2 SV=2)

HSP 1 Score: 335.495 bits (859), Expect = 2.449e-91
Identity = 173/324 (53.40%), Postives = 214/324 (66.05%), Query Frame = 1
Query:   43 MESKNSEKAKESDGDSAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHYYQHTVYLSQPTYGNHPNFFAAAGLAMKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIVTAYLKEDHXWCD 876
            M S+N   +  +  DS F  + RA + PI  V  A+ +DPSP+KLNLG G YRTEEGKPL+L+ VR+ E+ L+ND+S +KEY+PI GL +FNKLSAKLIFGADSPAI+ENRV+TVQ LSG+GSLR+G +FLAKHY+Q  +YL  PT+GNH   F  AGL +KTY YY P T GLDFQG+L+DLG+APS ++VLL A  HNPTG+DPT +QWEQIRQL+R K LLPFFD AY                                               V K+ D + RVES  +L+IRPMYS+PPIHGASIV A LK+   + D
Sbjct:    1 MASQNITPSPTASSDSVFAHLVRAPEDPILGVTVAYNKDPSPIKLNLGVGAYRTEEGKPLVLDVVRRVERQLLNDMSRNKEYIPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQGLSGTGSLRVGGEFLAKHYHQRIIYLPTPTWGNHTKVFNLAGLTVKTYRYYAPATRGLDFQGLLEDLGSAPSGSVVLLHACAHNPTGVDPTLEQWEQIRQLIRSKSLLPFFDSAYQGFASGSLDADAQPVRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVESQLKLVIRPMYSSPPIHGASIVAAILKDRDLYND 324          
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AAT4_ARATH (Aspartate aminotransferase, cytoplasmic isozyme 2 OS=Arabidopsis thaliana GN=ASP4 PE=2 SV=2)

HSP 1 Score: 307.76 bits (787), Expect = 5.469e-83
Identity = 160/310 (51.61%), Postives = 199/310 (64.19%), Query Frame = 1
Query:   85 DSAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHYYQHTVYLSQPTYGNHPNFFAAAGLAMKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIVTAYLKEDHXWCD 876
            +S    V  A + P+ +V+ A R+DPSP+KLNL  G YRTEEGKPL+L+ VR+AEQ L NDL  DKEYLP+ GLPEFNKLS KLI G DSPA+KENRV T QCLSG+GSLR+GA+FLA H  +  +++  PT+GNHP  F  AGL+++ + YYDPK+ GLDF+GML+DLGAAP  AIV+LQA  HNPTG+DPT +QWE+IR+L+R K LLPFFD AY                                               VC + D A +VE+   L++RPMY  PPIHGASIV   LK    + D
Sbjct:    2 NSILSSVLPAPEDPVLSVIFACRDDPSPVKLNLSAGTYRTEEGKPLVLDVVRRAEQQLANDL--DKEYLPLNGLPEFNKLSTKLILGDDSPALKENRVVTTQCLSGTGSLRVGAEFLATHNKESVIFVPNPTWGNHPRIFTLAGLSVQYFRYYDPKSRGLDFKGMLEDLGAAPPGAIVVLQACAHNPTGVDPTFEQWEKIRRLVRSKSLLPFFDSAYQGFASGSLDADAQAVRMFVADGGECLIAQSYAKNMGLYGERIGSLTIVCTSEDVAKKVENQVLLVVRPMYLTPPIHGASIVATILKNSDMYND 309          
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AAT5_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP5 PE=1 SV=2)

HSP 1 Score: 236.884 bits (603), Expect = 1.186e-61
Identity = 128/297 (43.10%), Postives = 169/297 (56.90%), Query Frame = 1
Query:   88 SAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHYYQHTVYLSQPTYGNHPNFFAAAGLAMKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIV 840
            S FE +  A   PI  V  AF+ D + MKLNLG G YRTEE +P +LN V++AE L++ +   +KEYLPI GL  FNK +A+L+FGA  P IKE RV+T+Q LSG+GSLR+ A  + +++    V +S PT+GNH N F  A +    Y YYDPKT GLDF+GM+ D+  AP  + +LL    HNPTGIDPT +QW +I  +++ K  +PFFD AY                                               VC + D A RV+S  + + RPMYSNPP+HGA IV
Sbjct:   51 SRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYVLNVVKKAENLML-ERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYDPKTIGLDFEGMIADIKEAPEGSFILLHGCAHNPTGIDPTPEQWVKIADVIQEKNHIPFFDVAYQGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPPVHGARIV 346          
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AATM_LUPAN (Aspartate aminotransferase P2, mitochondrial (Fragment) OS=Lupinus angustifolius PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 5.884e-61
Identity = 129/297 (43.43%), Postives = 169/297 (56.90%), Query Frame = 1
Query:   88 SAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHYYQHTVYLSQPTYGNHPNFFAAAGLAMKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIV 840
            S FE +  A   PI  V  AFR D S  KLNLG G YRTEE +P +L  V +AE L++ +   +KEYL I GL  FNK +A+L+ GAD+PAIK+ RV+TVQ LSG+GSLR+GA  + +++    V +S PT+GNH N F  A +    Y YYDPKT GLDF+GM++D+ AAP    VLL    HNPTGIDPT +QWE+I  +++ K  +PFFD AY                                               +  + + A RV+S  + + RPMYSNPP+HGA IV
Sbjct:   52 SRFEGIPMAPPDPILGVSEAFRADTSDAKLNLGVGAYRTEELQPYVLKVVNKAENLML-ERGQNKEYLAIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAALIERYFPGAKVLISAPTWGNHKNIFNDARVPWSEYRYYDPKTVGLDFEGMIEDIKAAPEGTFVLLHGCAHNPTGIDPTPEQWEKIADVIQEKNHIPFFDVAYQGFASGSLDEDAASVRLFVARGLEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRIARPMYSNPPVHGARIV 347          
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AATM_XENTR (Aspartate aminotransferase, mitochondrial OS=Xenopus tropicalis GN=got2 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.472e-59
Identity = 127/311 (40.84%), Postives = 169/311 (54.34%), Query Frame = 1
Query:   67 AKESDGDSAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHY-YQHTVYLSQPTYGNHPNFFAAAGLAMKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIVTAYLKE 858
            A +    S +  V      PI  V  AF+ D +  K+NLG G YR + GKP +L++VR+AE  L +  + DKEYLPI GL EF + SA+L  G +  AI+  R  TVQ +SG+GSLR+GA+FL + Y Y   VYL +P++GNH   F  AGL +K Y YYDPKT G DF G L D+   P  +I+L  A  HNPTG+DP  +QW+++  L++ +RL PFFD AY                                               VC   + A RVES  ++LIRPMYSNPP++GA I  A L +
Sbjct:   21 AVQGRASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSSVRKAEAQLASK-NLDKEYLPIGGLAEFARASAQLALGENCDAIQSGRFITVQTISGTGSLRVGANFLQRFYKYSRDVYLPKPSWGNHTPIFRDAGLEVKGYRYYDPKTCGFDFTGALDDISKIPEQSIILFHACAHNPTGVDPKQEQWKELAALIKSRRLFPFFDMAYQGFASGDTNRDAWAVRHFIQEGINVVLSQSYAKNMGLYGERVGAFTVVCSDAEEAKRVESQLKILIRPMYSNPPLNGARIAAAILTQ 330          
BLAST of EY659650 vs. ExPASy Swiss-Prot
Match: AATC_BOVIN (Aspartate aminotransferase, cytoplasmic OS=Bos taurus GN=GOT1 PE=1 SV=3)

HSP 1 Score: 224.942 bits (572), Expect = 4.662e-58
Identity = 126/309 (40.78%), Postives = 167/309 (54.05%), Query Frame = 1
Query:   88 SAFEQVARAADIPIYAVMAAFREDPSPMKLNLGFGVYRTEEGKPLLLNAVRQAEQLLVNDLSADKEYLPITGLPEFNKLSAKLIFGADSPAIKENRVSTVQCLSGSGSLRIGADFLAKHY-----YQHTVYLSQPTYGNHPNFFAAAGLA-MKTYHYYDPKTNGLDFQGMLQDLGAAPSXAIVLLQASGHNPTGIDPTAQQWEQIRQLMRLKRLLPFFDCAY----------------------------------------------XVCKTTDXAIRVESPAELLIRPMYSNPPIHGASIVTAYLKE 858
            S F +V +A  + ++ + A FREDP P K+NLG G YRT++ +P +L  VR+ EQ + ND S + EYLPI GL EF   +++L  G DSPA++E RV  VQCL G+G+LRIGA+FLA+ Y         VY+S PT+ NH   F AAG   +++YHY+D    GLD QG L DL  AP  +I +L A  HNPTG DPT +QW+QI  +M+ + L PFFD AY                                               V K  D  +RV S  E ++R  +SNPP  GA IV   L +
Sbjct:    5 SIFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDSQPWVLPVVRKVEQRIANDSSINHEYLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQCLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFIAAGFKDIRSYHYWDAAKRGLDLQGFLNDLEKAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGSLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMEKIVRITWSNPPAQGARIVARTLSD 313          
The following BLAST results are available for this feature:
BLAST of EY659650 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
AATC_DAUCA4.313e-9658.75Aspartate aminotransferase, cytoplasmic OS=Daucus ... [more]
AATC_ORYSJ2.796e-9557.76Aspartate aminotransferase, cytoplasmic OS=Oryza s... [more]
AAT3_ARATH2.617e-9352.87Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AAT2_ARATH2.449e-9156.11Aspartate aminotransferase, cytoplasmic isozyme 1 ... [more]
AAT1_MEDSA2.449e-9153.40Aspartate aminotransferase 1 OS=Medicago sativa GN... [more]
AAT4_ARATH5.469e-8351.61Aspartate aminotransferase, cytoplasmic isozyme 2 ... [more]
AAT5_ARATH1.186e-6143.10Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AATM_LUPAN5.884e-6143.43Aspartate aminotransferase P2, mitochondrial (Frag... [more]
AATM_XENTR2.472e-5940.84Aspartate aminotransferase, mitochondrial OS=Xenop... [more]
AATC_BOVIN4.662e-5840.78Aspartate aminotransferase, cytoplasmic OS=Bos tau... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-E11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659650 ID=EY659650|Name=EY659650|organism=Citrus sinensis|type=EST|length=885bp
AATTTATCTAATTATCGTAGTCTCTCAAGTTCAGCATACAAAATGGAGTC
AAAGAATTCTGAAAAAGCAAAGGAATCTGATGGCGATTCTGCTTTTGAAC
AAGTTGCTCGGGCTGCAGATATTCCCATCTATGCGGTGATGGCTGCTTTC
AGAGAAGACCCCAGCCCAATGAAGCTGAATTTAGGCTTTGGCGTTTATCG
TACAGAGGAAGGAAAGCCACTGCTTCTTAATGCAGTTAGGCAAGCTGAGC
AGTTACTAGTTAATGACTTGTCTGCCGATAAGGAGTACTTGCCCATTACG
GGTCTTCCAGAATTTAATAAATTGAGTGCCAAGCTTATTTTTGGTGCTGA
CAGCCCTGCTATCAAGGAGAACAGGGTGAGCACTGTCCAGTGCTTATCTG
GTAGTGGCTCACTGAGGATTGGAGCTGATTTTTTAGCAAAACATTACTAC
CAACACACAGTGTACTTGTCCCAGCCAACATATGGAAATCATCCGAATTT
TTTTGCTGCAGCAGGGTTAGCTATGAAGACTTACCATTACTATGATCCCA
AAACAAATGGGCTGGACTTTCAAGGCATGTTGCAAGACCTTGGTGCTGCT
CCATCANGAGCCATTGTGCTTCTCCAAGCATCTGGTCATAATCCTACCGG
AATTGATCCAACTGCCCAGCAGTGGGAGCAAATCAGACAGTTGATGAGAT
TAAAAAGGCTATTACCTTTTTTTGATTGTGCTTATCANGTTTGCAAGACA
ACTGATNGTGCTATCCGGGTTGAGAGCCCAGCTGAACTTTTGATTAGACC
TATGTACTCGAATCCTCCCATTCATGGTGCATCCATAGTGACTGCGTATC
TGAAGGAAGATCATNCATGGTGTGACATTCTGAGT
back to top