EY659647

Overview
NameEY659647
Unique NameEY659647
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCH11_ORYSJ (Cyclin-H1-1 OS=Oryza sativa subsp. japonica GN=CYCH1-1 PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.881e-87
Identity = 161/275 (58.55%), Postives = 205/275 (74.55%), Query Frame = 3
Query:   36 DGSFSYPEPQNNAKDNSEKHSRPKPLNIEEEQSMRVFYENKLREVCSAFYFPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSAEELGKGISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMEDFCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAALRNSNKVQRVVNYESYLSSILSRQIAGHIISDLTXNLDTIDSWGYEYKXPSRKGYEHINRKTEIXWGPWLT*RE*KTGKESKHSAR 860
            DGS SYPEP   A D+    S  KPL+ EEE+ MRVFYE K++EVCSAF FP+KIQATA++YFKRFYLQWSVMEHHPK+IMLTC+Y++CK+EENHVSAEELGKGI QDHQ+ILN EMIV ++L+FDLIVY PYR +EGF++DMEDFC+  NGE Q L+DL +TA  +VDK+MLTDAPLL+ PGQLALAAL  SN + +++N+E YL S+ SRQ +   I     +++ I+    + K P+ K   HI+RK +    P       K  K+SKH ++
Sbjct:   49 DGSLSYPEP---APDHVVGSSGVKPLSCEEERLMRVFYEQKIQEVCSAFKFPHKIQATAIIYFKRFYLQWSVMEHHPKHIMLTCIYSSCKVEENHVSAEELGKGIQQDHQIILNNEMIVLKSLDFDLIVYAPYRSIEGFVDDMEDFCRAGNGEHQRLQDLRQTAISQVDKMMLTDAPLLYTPGQLALAALHKSNDMHKILNFERYLESVFSRQHSDCPIEQFVGSINMINYLVEQLKIPTPKDMRHIDRKLKHCLDPSSQDEHKKKEKKSKHKSK 320          
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCH11_ARATH (Cyclin-H1-1 OS=Arabidopsis thaliana GN=CYCH1-1 PE=1 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.338e-84
Identity = 161/276 (58.33%), Postives = 206/276 (74.64%), Query Frame = 3
Query:   33 ADGSFSYPEPQNNAKDNSEKHSRPKPLNIEEEQSMRVFYENKLREVCSAFYFPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSAEELGKGISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMEDFCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAALRNSNKVQRVVNYESYLSSILSRQIAGHIISDLTXNLDTIDSWGYEYKXPSRKGYEHINRKTEIXWGPWLT*RE-*KTGKESKHSA 857
            A GS +YP+ +  + D ++K  + KPL+ +EE+ MR FYE K++EVCSAF FP+KIQATAL YFKRFYLQWSVM+HHPK IMLTCVYAACKIEENHVSAEE+GKGI+QDH++IL YEM V Q+LEFDLIVY PYR +EGF+N+ME+F Q ++ E+Q L+ L + A  E DK+MLTDAPLLFPPGQLALA+LR +N V  V++++ YL +I+S+  + H  S+LT  LD I+     YK PS K  +HINRK +   G   +  E  K  K SKH +
Sbjct:   47 ASGSLTYPKDKVGSGDQADK--KLKPLSADEERFMRAFYEAKVQEVCSAFAFPHKIQATALQYFKRFYLQWSVMQHHPKEIMLTCVYAACKIEENHVSAEEIGKGINQDHRIILKYEMAVLQSLEFDLIVYAPYRAIEGFVNNMEEFLQARDDEIQKLESLLKGATAEADKVMLTDAPLLFPPGQLALASLRIANGVLGVIDFDRYLENIVSQPNSEHTTSELTKLLDNIEYLVKNYKCPSEKDMKHINRKLKSCLGHSSSHDESKKREKRSKHKS 320          
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCNH_RAT (Cyclin-H OS=Rattus norvegicus GN=Ccnh PE=2 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 2.928e-31
Identity = 89/240 (37.08%), Postives = 136/240 (56.67%), Query Frame = 3
Query:  108 PLNIE--EEQSMRVFYENKLREVCSAFY--FPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSA-------EELGKGISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMED-FCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAALRNSNKVQRVVNYESYLSSILSRQIAGHIISDLTXNLDTIDSWGYEYKXPSRKGYEHINRKTE 791
            PL +E  EE ++  +YE +L E CS F    P  +  TA +YFKRFYL  SVME+HP+ IMLTC + ACK++E +VS+        E   G  +  + IL YE+++ Q L F LIV+ PYRP EGF+ D++  +  ++N E+     L +TA   + +I LTDA LL+ P Q+AL A+ +S   +  +  ESYLS  L  +     +S L   + ++ +   +Y+ P  +    + +K E
Sbjct:   45 PLFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPMLENPEI-----LRKTADDFLSRIALTDAYLLYTPSQIALTAILSSAS-RAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAILKQKLE 278          
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCNH_MACFA (Cyclin-H OS=Macaca fascicularis GN=CCNH PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.824e-31
Identity = 88/240 (36.67%), Postives = 135/240 (56.25%), Query Frame = 3
Query:  102 PKPLNIEEEQSMRVFYENKLREVCSAFY--FPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSA-------EELGKGISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMED-FCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAALRNSNKVQRVVNYESYLSSILSRQIAGHIISDLTXNLDTIDSWGYEYKXPSRKGYEHINRKTE 791
            P  L   EE ++  +YE +L E CS F    P  +  TA +YFKRFYL  SVME+HP+ IMLTC + ACK++E +VS+        E   G  +  + IL YE+++ Q L F LIV+ PYRP EGF+ D++  +  ++N E+     L +TA   +++I LTDA LL+ P Q+AL A+ +S   +  +  ESYLS  L  +     +S L   + ++ +   +Y+ P  +    + +K E
Sbjct:   45 PVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEI-----LRKTADDFLNRIALTDAYLLYTPSQIALTAILSSAS-RAGITMESYLSESLMLRENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLE 278          
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCNH_HUMAN (Cyclin-H OS=Homo sapiens GN=CCNH PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.824e-31
Identity = 88/240 (36.67%), Postives = 135/240 (56.25%), Query Frame = 3
Query:  102 PKPLNIEEEQSMRVFYENKLREVCSAFY--FPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSA-------EELGKGISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMED-FCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAALRNSNKVQRVVNYESYLSSILSRQIAGHIISDLTXNLDTIDSWGYEYKXPSRKGYEHINRKTE 791
            P  L   EE ++  +YE +L E CS F    P  +  TA +YFKRFYL  SVME+HP+ IMLTC + ACK++E +VS+        E   G  +  + IL YE+++ Q L F LIV+ PYRP EGF+ D++  +  ++N E+     L +TA   +++I LTDA LL+ P Q+AL A+ +S   +  +  ESYLS  L  +     +S L   + ++ +   +Y+ P  +    + +K E
Sbjct:   45 PVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEI-----LRKTADDFLNRIALTDAYLLYTPSQIALTAILSSAS-RAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLE 278          
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCNH_BOVIN (Cyclin-H OS=Bos taurus GN=CCNH PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.522e-31
Identity = 87/240 (36.25%), Postives = 135/240 (56.25%), Query Frame = 3
Query:  102 PKPLNIEEEQSMRVFYENKLREVCSAFY--FPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSA-------EELGKGISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMED-FCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAALRNSNKVQRVVNYESYLSSILSRQIAGHIISDLTXNLDTIDSWGYEYKXPSRKGYEHINRKTE 791
            P  L   EE ++  +YE +L E CS F    P  +  TA +YFKRFYL  SVME+HP+ IMLTC + ACK++E +VS+        E   G  +  + IL YE+++ Q L F LIV+ PYRP EGF+ D++  +  ++N E+     L +TA   ++++ LTDA LL+ P Q+AL A+ +S   +  +  ESYLS  L  +     +S L   + ++ +   +Y+ P  +    + +K E
Sbjct:   45 PVFLEPHEEITLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKTLEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPLLENPEI-----LRKTADDFLNRVALTDAHLLYTPSQIALTAILSSAS-RAGITMESYLSESLMLKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLE 278          
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCNH_MOUSE (Cyclin-H OS=Mus musculus GN=Ccnh PE=2 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 8.519e-31
Identity = 88/240 (36.67%), Postives = 133/240 (55.42%), Query Frame = 3
Query:  102 PKPLNIEEEQSMRVFYENKLREVCSAFY--FPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSA-------EELGKGISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMED-FCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAALRNSNKVQRVVNYESYLSSILSRQIAGHIISDLTXNLDTIDSWGYEYKXPSRKGYEHINRKTE 791
            P  L   EE ++  +YE +L E CS F    P  +  TA +YFKRFYL  SVME+HP+ IMLTC + ACK++E +VS+        E   G  +  + IL YE+++ Q L F LIV+ PYRP EGF+ D++  +  ++N E+     L +TA   + +I LTDA LL+ P Q+AL A+ +S   +  +  ESYLS  L  +     +S L   + ++ +   +Y+ P       + +K E
Sbjct:   45 PVFLEPHEELTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQERALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPMLENPEI-----LRKTADDFLSRIALTDAYLLYTPSQIALTAILSSAS-RAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSDEVAVLKQKLE 278          
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCNH_XENLA (Cyclin-H OS=Xenopus laevis GN=ccnh PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.898e-30
Identity = 87/237 (36.71%), Postives = 135/237 (56.96%), Query Frame = 3
Query:    9 EQHKWRLIADGSFSYPEPQNNAKDNSEKHSRPKP-------LNIEEEQSMRVFYENKLREVCSAFY--FPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSAEE----LGK---GISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMED-FCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAALRNSNKVQRVVNYESYLSSILS 668
            ++  W  +++        Q N +  +   +  KP       L   EE ++  +YE +L + C+AF    P  +  TA +YFKRFYL  SVMEHHP+ IMLTCV+ ACK++E +VS+ +    LG+   G  +  + IL YE+++ Q L F LIV+ PYRP EGF+ D++  +  ++N E+     L ++A   ++++ LTDA LLF P  +AL A+  S   +  +N ESYL+  LS
Sbjct:    7 QKKHWTFLSEDEPLRRRIQANVRYRARIRATEKPRLSEIFSLEPHEELAICKYYEKRLLDFCNAFKPTMPKSVLGTACMYFKRFYLNNSVMEHHPRIIMLTCVFLACKVDEFNVSSIQFVGNLGENPLGQEKILEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDVKTRYPMLENPEV-----LRKSADEFLNRVALTDACLLFAPSVIALTAIL-STASRAGLNMESYLTECLS 237          
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCNH_DICDI (Putative cyclin-H OS=Dictyostelium discoideum GN=cycH PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.838e-25
Identity = 62/174 (35.63%), Postives = 98/174 (56.32%), Query Frame = 3
Query:   96 SRPKPLNIEEEQSMRVFYENKLREVCSAFYFPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSAEELGKGISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMEDFCQVKNGELQM----LKDLHETAKLEVDKIMLTDAPLLFPPGQLALAAL 605
            S P  L+ ++E S+  +YE K  E+  A   P+K+ A A++Y KRFYL+ S+M++  K +ML+C++ ACK E+NH+  +            I N E+I+ ++L F+LIVY P+RP+ G+I D+ D   + N    +       L ET K  + K + +D    F P  +ALA L
Sbjct:   41 SEPNILSPDDELSLIHYYETKTLEIAMALNLPDKVSAPAIIYIKRFYLKNSIMQYGAKLVMLSCLFIACKTEDNHLDIDYYSNITKASPSDITNLEIIILESLNFNLIVYHPFRPMYGYILDINDNSAIYNNTNGVSPIKFDTLWETCKKSIQKSLFSDCCFEFHPQIIALACL 214          
BLAST of EY659647 vs. ExPASy Swiss-Prot
Match: CCL1_YEAST (Cyclin CCL1 OS=Saccharomyces cerevisiae GN=CCL1 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.103e-21
Identity = 51/166 (30.72%), Postives = 92/166 (55.42%), Query Frame = 3
Query:  108 PLNIEEEQSMRVFYENKLREVCSAFYFPNKIQATALLYFKRFYLQWSVMEHHPKNIMLTCVYAACKIEENHVSAEELGKGISQDHQMILNYEMIVYQALEFDLIVYPPYRPLEGFINDMEDFCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAAL 605
            PL +EEE  +  FY  K++ +      P ++ ATA+ +F+RF+L+ SVM+  PK+I+ T ++ ACK E   +S +   +        +L +E  + ++L+F L+ + PY+PL GF  D+++    K  +L  +  +++  K  +   +LTD    + P Q+ LA L
Sbjct:  107 PLTMEEELDLVNFYAKKVQVIAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKSIVHTTIFLACKSENYFISVDSFAQKAKSTRDSVLKFEFKLLESLKFSLLNHHPYKPLHGFFLDIQNVLYGK-VDLNYMGQIYDRCKKRITAALLTDVVYFYTPPQITLATL 271          
The following BLAST results are available for this feature:
BLAST of EY659647 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
CCH11_ORYSJ2.881e-8758.55Cyclin-H1-1 OS=Oryza sativa subsp. japonica GN=CYC... [more]
CCH11_ARATH1.338e-8458.33Cyclin-H1-1 OS=Arabidopsis thaliana GN=CYCH1-1 PE=... [more]
CCNH_RAT2.928e-3137.08Cyclin-H OS=Rattus norvegicus GN=Ccnh PE=2 SV=2[more]
CCNH_MACFA3.824e-3136.67Cyclin-H OS=Macaca fascicularis GN=CCNH PE=2 SV=1[more]
CCNH_HUMAN3.824e-3136.67Cyclin-H OS=Homo sapiens GN=CCNH PE=1 SV=1[more]
CCNH_BOVIN6.522e-3136.25Cyclin-H OS=Bos taurus GN=CCNH PE=2 SV=1[more]
CCNH_MOUSE8.519e-3136.67Cyclin-H OS=Mus musculus GN=Ccnh PE=2 SV=2[more]
CCNH_XENLA1.898e-3036.71Cyclin-H OS=Xenopus laevis GN=ccnh PE=1 SV=1[more]
CCNH_DICDI1.838e-2535.63Putative cyclin-H OS=Dictyostelium discoideum GN=c... [more]
CCL1_YEAST2.103e-2130.72Cyclin CCL1 OS=Saccharomyces cerevisiae GN=CCL1 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-E08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659647 ID=EY659647|Name=EY659647|organism=Citrus sinensis|type=EST|length=904bp
ANAATTTGGAACAACACAAATGGAGGTTGATCGCTGATGGGTCATTTTCA
TACCCAGAACCTCAAAATAATGCCAAGGACAACAGTGAAAAGCATTCTCG
TCCGAAACCCCTCAATATCGAAGAGGAACAGTCTATGCGAGTATTTTATG
AGAATAAACTTCGCGAAGTATGCAGTGCATTTTATTTTCCTAATAAAATT
CAGGCAACGGCTCTGTTATACTTCAAAAGGTTCTATCTGCAATGGTCGGT
CATGGAACATCACCCAAAAAATATAATGTTAACTTGTGTATATGCAGCTT
GTAAGATAGAGGAAAATCATGTTTCAGCAGAGGAGCTTGGCAAGGGAATT
TCACAGGATCATCAAATGATTCTCAACTATGAAATGATCGTTTATCAGGC
TTTGGAATTTGATCTTATCGTTTATCCACCATATCGTCCACTTGAAGGAT
TTATTAATGATATGGAAGATTTCTGCCAAGTAAAGAATGGCGAATTGCAG
ATGCTGAAGGATTTGCACGAAACTGCAAAGTTGGAAGTTGACAAAATCAT
GCTTACTGATGCACCACTTCTATTCCCCCCTGGGCAGTTGGCATTGGCTG
CTTTACGAAATTCAAACAAGGTTCAAAGAGTTGTCAACTACGAGAGTTAC
TTGAGCAGCATTCTATCTCGTCAAATTGCTGGGCACATCATTTCAGACCT
TACTNGAAATTTAGACACCATAGATTCCTGGGGGTATGAATATAAGTNCC
CCTCCAGAAAGGGATATGAGCACATCAACAGAAAAACTGAAATCTGNTGG
GGGCCATGGCTCACATGACGTGAGTAAAAAACGGGAAAAGAATCAAAGCA
TAGTGCAAGAGTTACATGGGATGCAAAATGGGCATAAATTCGGGAACCTA
TGCT
back to top