EY659646

Overview
NameEY659646
Unique NameEY659646
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length593
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1053 contig Csv1_Contig1053:241..834. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: BT3L4_XENTR (Transcription factor BTF3 homolog 4 OS=Xenopus tropicalis GN=btf3l4 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 8.212e-24
Identity = 54/110 (49.09%), Postives = 81/110 (73.64%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++ +N I  IEEVN+ KDD  VI F NPKVQAS++ANT+ ++G  + K++ ++LPGI++QLG D+L +LRKLAEQF +Q  ++    P   E++DD+VPELV
Sbjct:   37 KKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKASKPEDIEEEDDDVPELV 146          
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: BT3L4_XENLA (Transcription factor BTF3 homolog 4 OS=Xenopus laevis GN=btf3l4 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 8.212e-24
Identity = 54/110 (49.09%), Postives = 81/110 (73.64%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++ +N I  IEEVN+ KDD  VI F NPKVQAS++ANT+ ++G  + K++ ++LPGI++QLG D+L +LRKLAEQF +Q  ++    P   E++DD+VPELV
Sbjct:   37 KKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKASKPEDIEEEDDDVPELV 146          
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: BTF3_MOUSE (Transcription factor BTF3 OS=Mus musculus GN=Btf3 PE=2 SV=3)

HSP 1 Score: 106.686 bits (265), Expect = 9.079e-23
Identity = 57/110 (51.82%), Postives = 80/110 (72.73%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++G+N I  IEEVN+F +   VI F NPKVQAS+AANT+ ++G  +TK+L ++LP I+NQLG D+L +LR+LAE   KQ+ + G     T EDDDDEVP+LV
Sbjct:   84 KKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVD-GKAPLATGEDDDDEVPDLV 192          
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: BTF3_HUMAN (Transcription factor BTF3 OS=Homo sapiens GN=BTF3 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 9.079e-23
Identity = 57/110 (51.82%), Postives = 80/110 (72.73%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++G+N I  IEEVN+F +   VI F NPKVQAS+AANT+ ++G  +TK+L ++LP I+NQLG D+L +LR+LAE   KQ+ + G     T EDDDDEVP+LV
Sbjct:   86 KKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVD-GKAPLATGEDDDDEVPDLV 194          
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: BT3L4_BOVIN (Transcription factor BTF3 homolog 4 OS=Bos taurus GN=BTF3L4 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 9.079e-23
Identity = 52/110 (47.27%), Postives = 81/110 (73.64%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++ +N I  IEEVN+ KDD  VI F NPKVQAS++ANT+ ++G  + K + ++LPGI++QLG D+L +LRKLAEQF +Q  ++ T  P   ++++D+VP+LV
Sbjct:   37 KKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKTPKPEDIDEEEDDVPDLV 146          
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: BT3L4_PONAB (Transcription factor BTF3 homolog 4 OS=Pongo abelii GN=BTF3L4 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.186e-22
Identity = 52/110 (47.27%), Postives = 80/110 (72.73%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++ +N I  IEEVN+ KDD  VI F NPKVQAS++ANT+ ++G  + K + ++LPGI++QLG D+L +LRKLAEQF +Q  ++    P   +++DD+VP+LV
Sbjct:   37 KKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLV 146          
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: BT3L4_MOUSE (Transcription factor BTF3 homolog 4 OS=Mus musculus GN=Btf3l4 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.186e-22
Identity = 52/110 (47.27%), Postives = 80/110 (72.73%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++ +N I  IEEVN+ KDD  VI F NPKVQAS++ANT+ ++G  + K + ++LPGI++QLG D+L +LRKLAEQF +Q  ++    P   +++DD+VP+LV
Sbjct:   37 KKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLV 146          
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: BT3L4_HUMAN (Transcription factor BTF3 homolog 4 OS=Homo sapiens GN=BTF3L4 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.186e-22
Identity = 52/110 (47.27%), Postives = 80/110 (72.73%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++ +N I  IEEVN+ KDD  VI F NPKVQAS++ANT+ ++G  + K + ++LPGI++QLG D+L +LRKLAEQF +Q  ++    P   +++DD+VP+LV
Sbjct:   37 KKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLV 146          
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: BT3L4_DANRE (Transcription factor BTF3 homolog 4 OS=Danio rerio GN=btf3l4 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 4.506e-22
Identity = 53/110 (48.18%), Postives = 80/110 (72.73%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++ +N I  IEEVN+ KDD  VI F NPKVQAS++ANT+ ++G  +TK+L ++LPGI++QLG D+L +LRKLAEQF +Q  +         +++DD+VP+LV
Sbjct:   37 KKLQSSLKKLVVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKLAEQFPRQVLDNKAPKAEDIDEEDDDVPDLV 146          
BLAST of EY659646 vs. ExPASy Swiss-Prot
Match: NACB_AJECN (Nascent polypeptide-associated complex subunit beta OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=EGD1 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.311e-21
Identity = 53/111 (47.75%), Postives = 77/111 (69.37%), Query Frame = 1
Query:    1 QKVSEHLEEIGLNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQK-QAPNAGTGAPTTQEDDDDEVPELV 327
            +K+   L+++ +  I AIEEVN+FK+D  VI F  PKV AS+ +NT+ + G  + K+L +++PGI+NQLGPD+L +LRKLAE +Q  Q    G  A    +DDDDE+P+LV
Sbjct:   38 KKLQTSLKKLNVQPIQAIEEVNMFKEDGNVIHFAAPKVHASVPSNTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQSMQKGEGGEDAKKDDDDDDDEIPDLV 148          
The following BLAST results are available for this feature:
BLAST of EY659646 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
BT3L4_XENTR8.212e-2449.09Transcription factor BTF3 homolog 4 OS=Xenopus tro... [more]
BT3L4_XENLA8.212e-2449.09Transcription factor BTF3 homolog 4 OS=Xenopus lae... [more]
BTF3_MOUSE9.079e-2351.82Transcription factor BTF3 OS=Mus musculus GN=Btf3 ... [more]
BTF3_HUMAN9.079e-2351.82Transcription factor BTF3 OS=Homo sapiens GN=BTF3 ... [more]
BT3L4_BOVIN9.079e-2347.27Transcription factor BTF3 homolog 4 OS=Bos taurus ... [more]
BT3L4_PONAB1.186e-2247.27Transcription factor BTF3 homolog 4 OS=Pongo abeli... [more]
BT3L4_MOUSE1.186e-2247.27Transcription factor BTF3 homolog 4 OS=Mus musculu... [more]
BT3L4_HUMAN1.186e-2247.27Transcription factor BTF3 homolog 4 OS=Homo sapien... [more]
BT3L4_DANRE4.506e-2248.18Transcription factor BTF3 homolog 4 OS=Danio rerio... [more]
NACB_AJECN1.311e-2147.75Nascent polypeptide-associated complex subunit bet... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-E07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659646 ID=EY659646|Name=EY659646|organism=Citrus sinensis|type=EST|length=593bp
CAGAAGGTTTCAGAGCACCTTGAAGAGATAGGACTGAATGCTATTCCTGC
AATTGAGGAAGTTAACATTTTCAAGGATGACGTCGTTATTCAGTTCTTAA
ATCCCAAAGTACAAGCTTCAATTGCTGCCAACACATGGGTAGTTAGTGGT
GCCCCACAAACCAAGAAGTTGCAGGATATTCTCCCTGGAATTATCAATCA
ATTGGGGCCAGATAATTTGGACAACCTGAGGAAGTTGGCGGAGCAGTTTC
AGAAGCAAGCACCTAATGCAGGAACTGGTGCACCCACGACTCAAGAGGAC
GACGACGATGAGGTCCCAGAGCTTGTGGCAGGCGAGACGTTTGAAGCTGC
CGCAGAGGAGAAAACAGAGAAACCTGACGCTGCTTCTTAGAGAGTTTTAT
CTAGAGGGACTTTGTGTTATTCTATATATTTTCTATGTTTTTTGAGCTTT
TATTTTACTTTTCCGAGTCAACTTTCTCTTGTTTTATCTGATTCTCCCTG
TGACACTAGATATTGTTACTTTTAATTCAATGTTTTGCTCCAGTGAAACC
AGTGAAAACCTTTTTACTCTTTCAAAAAAAAAAAAAAAAAAAA
back to top