EY659644

Overview
NameEY659644
Unique NameEY659644
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length716
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3513 contig Csv1_Contig3513:245..923. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659644 vs. ExPASy Swiss-Prot
Match: CAX1A_ORYSJ (Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.213e-12
Identity = 38/79 (48.10%), Postives = 50/79 (63.29%), Query Frame = 2
Query:   20 VGMDLNFNLLETGSXXXXXXXXXXXXQDGTSHYMKGFVLLLCYFVIGACFFVSNRPL-DSDQNGVKMGLQSSTGTVLRA 253
            V MDL+F LLETGS            QDGTSHY+KG +LLLCY VIGACFFV+ +P   ++ NG  + + + + +V  A
Sbjct:  373 VQMDLDFKLLETGSLFMAVLVTAFTLQDGTSHYLKGILLLLCYIVIGACFFVARQPAGHANSNGALLDVPTGSMSVQAA 451          
BLAST of EY659644 vs. ExPASy Swiss-Prot
Match: CAX3_ARATH (Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.702e-12
Identity = 37/69 (53.62%), Postives = 42/69 (60.87%), Query Frame = 2
Query:   20 VGMDLNFNLLETGSXXXXXXXXXXXXQDGTSHYMKGFVLLLCYFVIGACFFVSNRPLDSDQNGVKMGLQ 226
            + MDLNFN+LET S            QDGTSHYMKG VLLLCY +I ACFFV   P     N + +GLQ
Sbjct:  383 IKMDLNFNILETSSLALAIIITAFTLQDGTSHYMKGLVLLLCYVIIAACFFVDQIP---QPNDLDVGLQ 448          
BLAST of EY659644 vs. ExPASy Swiss-Prot
Match: CAX1_ARATH (Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3)

HSP 1 Score: 71.633 bits (174), Expect = 4.609e-12
Identity = 36/75 (48.00%), Postives = 42/75 (56.00%), Query Frame = 2
Query:   20 VGMDLNFNLLETGSXXXXXXXXXXXXQDGTSHYMKGFVLLLCYFVIGACFFVSNRPLDSDQNGVKMGLQSSTGTV 244
            + MDLNF  LETG             QDG+SHYMKG VLLLCYF+I  CFFV   P    QN + +G Q+    V
Sbjct:  381 INMDLNFGPLETGCLAVSIIITAFTLQDGSSHYMKGLVLLLCYFIIAICFFVDKLP--QKQNAIHLGHQAMNNVV 453          
BLAST of EY659644 vs. ExPASy Swiss-Prot
Match: CAX4_ARATH (Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 6.019e-12
Identity = 35/56 (62.50%), Postives = 37/56 (66.07%), Query Frame = 2
Query:   20 VGMDLNFNLLETGSXXXXXXXXXXXXQDGTSHYMKGFVLLLCYFVIGACFFVSNRP 187
            + MDLNFNLLET              QDGTS+YMKG VLLLCY VI ACFFVSN P
Sbjct:  385 IEMDLNFNLLETACFALSILVTSLVLQDGTSNYMKGLVLLLCYVVIAACFFVSNSP 440          
The following BLAST results are available for this feature:
BLAST of EY659644 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
CAX1A_ORYSJ1.213e-1248.10Vacuolar cation/proton exchanger 1a OS=Oryza sativ... [more]
CAX3_ARATH2.702e-1253.62Vacuolar cation/proton exchanger 3 OS=Arabidopsis ... [more]
CAX1_ARATH4.609e-1248.00Vacuolar cation/proton exchanger 1 OS=Arabidopsis ... [more]
CAX4_ARATH6.019e-1262.50Vacuolar cation/proton exchanger 4 OS=Arabidopsis ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-E05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659644 ID=EY659644|Name=EY659644|organism=Citrus sinensis|type=EST|length=716bp
CGGACGCGTGGGCGGACGCGTGGGAATGGATCTTAACTTCAATCTCCTTG
AGACTGGCTCTCTTGCTCTAGCAATTATTGCCACAGCCTTCACTCTACAG
GATGGAACTTCTCATTACATGAAAGGATTTGTTCTTCTGCTATGCTACTT
TGTTATTGGAGCATGCTTTTTTGTATCCAACAGACCACTCGACTCCGACC
AGAATGGGGTCAAAATGGGCCTTCAATCATCAACTGGAACAGTCCTCAGA
GCATGATAAGACTAATTGGGCCTTCTGGGGTCAGACTCTTCAATTCGTCA
TTGAAACTTTCAAATATAAGGTGCATTGCTAATTCTTTCATTTGGCGTCG
CCAGCTGGAATTTAGAAGCCGGGCATAGCATTTTACATGTCGAGAAAGTT
TCCATGGATGCCTTCTCATTTGAGATGAAACATTTCAAAGTGAATTGGTG
CCATTGAAGCTTGATGAAGGCAGCGCANGTTAAAGTATATGTAATGTTCT
AAAGATCTCTCTCAGATGGTTTTTTTTAACTGAGTGAAAGTTTATTTCGT
ATGTCGGTATATGCATTTACTCTTCGTTTGAGTGATGGTAATTTCTCGGC
TCTTGTATACCATCATCATAATAAAATGGGAATTCATTGTCTTTGGGCTT
GAATTAATTGTTTTTTCCATGATTCACCAAATTTCCGGTGTGACAGTGCA
AAAAAAAAAAAAAAAA
back to top