EY659643

Overview
NameEY659643
Unique NameEY659643
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length939
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSMD3_TOBAC (Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Nicotiana tabacum GN=21D7 PE=2 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 3.690e-109
Identity = 221/314 (70.38%), Postives = 232/314 (73.89%), Query Frame = 3
Query:    3 SSGAPAPAKHPLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXIVGCXHMSLXLGCXT---SASRILASHFADVXRS*DGTXXXXXXXXXXXXQGNSRWCD*CTVDHAMGWM 935
            +SGA AP K+PLPELEIYCYLLVLIFLID+K+YNEAKACSSASIARLK +NRRTVDVLA+RLYFYYSLCYELTGDLAEIRG LLALHRIATLRHDELGQET               DQAEKL SKAPRFEAHSNQQF RYLFYLGKIRTIQLEYTDAKESLLQAARKAP AALGFRVQCNKWAIIVRLLL +IPERTVFMQ GMEKAL   FELTNAVRIGD ELF+  AEK SSTFSSD T+  IV   H  +  G      S SRI     A   R  D                     D  T+DHA GWM
Sbjct:  103 TSGAQAPIKNPLPELEIYCYLLVLIFLIDQKKYNEAKACSSASIARLKTVNRRTVDVLASRLYFYYSLCYELTGDLAEIRGYLLALHRIATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFSRYLFYLGKIRTIQLEYTDAKESLLQAARKAPQAALGFRVQCNKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRKVAEKFSSTFSSDGTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRL-DSPNPVADAESIVSKAIRDGAID-ATLDHANGWM 414          
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSMD3_DAUCA (Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Daucus carota GN=21D7 PE=1 SV=2)

HSP 1 Score: 387.111 bits (993), Expect = 7.695e-107
Identity = 209/306 (68.30%), Postives = 226/306 (73.86%), Query Frame = 3
Query:   24 AKHPLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXIVGCXHMSLXLGCXTSASRILASHFADVXRS--*DGTXXXXXXXXXXXXQGNSRWCD*CTVDHAMGWM 935
            AKH LPELEIYCYLLVLIFLID+K+Y+EAKACSSASIAR+KN+NRRTV+VLA+RLYFYYSL YELTGDLAEIRGNLLALHRIATLRHDELGQET               DQAEKL SKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKES LQAARKAPVAALGFRVQCNKWA+IVRLLL +IPERTVFMQ GMEKAL   F LTNAVRIGD ELF+  A+K +STF++DRTH  IV   H  +  G    +         DV R    D                     D  T+DHA GWM
Sbjct:  111 AKHSLPELEIYCYLLVLIFLIDQKKYSEAKACSSASIARVKNLNRRTVEVLASRLYFYYSLSYELTGDLAEIRGNLLALHRIATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESXLQAARKAPVAALGFRVQCNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFXLTNAVRIGDLELFRXVADKFASTFTADRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVARKLRLDSPNPVADAESIVSKAIRDGAID-ATIDHANGWM 415          
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSD31_ARATH (Probable 26S proteasome non-ATPase regulatory subunit 3a OS=Arabidopsis thaliana GN=EMB2719 PE=1 SV=3)

HSP 1 Score: 368.622 bits (945), Expect = 1.934e-101
Identity = 187/257 (72.76%), Postives = 207/257 (80.54%), Query Frame = 3
Query:    3 SSGAPAPAKHPLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXIVGCXHMSLXLG 773
            S+   AP+KH   ELEIYCY +VL+FLID+K+YNEAKACSSASIARLKN+NRRT+DV+A+RLYFYYSL YE TGDLAEIRG LLALH  ATLRHDELGQET               DQAEKL SKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAP+AALGFR+QCNKWAI+VRLLL +IPER++F Q GMEKAL   FELTNAVRIGD ELF++  EK   TF+ DRTH  IV   H  +  G
Sbjct:  103 SATQAAPSKHLPAELEIYCYFIVLLFLIDQKKYNEAKACSSASIARLKNVNRRTIDVIASRLYFYYSLSYEQTGDLAEIRGTLLALHHSATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQCNKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTG 359          

HSP 2 Score: 23.0978 bits (48), Expect = 1.934e-101
Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 1
Query:  880 KAIRDGAIDA 909
            KAIRDGAIDA
Sbjct:  396 KAIRDGAIDA 405          
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSD32_ARATH (Probable 26S proteasome non-ATPase regulatory subunit 3b OS=Arabidopsis thaliana GN=At1g75990 PE=2 SV=2)

HSP 1 Score: 360.533 bits (924), Expect = 5.149e-99
Identity = 184/257 (71.60%), Postives = 203/257 (78.99%), Query Frame = 3
Query:    3 SSGAPAPAKHPLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXIVGCXHMSLXLG 773
            SS + AP KH   ELEIYCY +VL+FLID+K+YNEAK CS+ASIARLK++NRRTVDV+A++LYFYYSL YELT DLAEIR  LLALH  ATLRHDELGQET               DQAEKL SKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVA+LGFR+QCNKWAIIVRLLL +IPER++F Q GMEK L   FELTNAVRIGD ELF    EK + TF+ DRTH  IV   H  +  G
Sbjct:  102 SSNSQAPPKHLPAELEIYCYFIVLLFLIDQKKYNEAKVCSTASIARLKSVNRRTVDVIASKLYFYYSLSYELTNDLAEIRSTLLALHHSATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVASLGFRIQCNKWAIIVRLLLGEIPERSIFTQKGMEKTLRPYFELTNAVRIGDLELFGKIQEKFAKTFAEDRTHNLIVRLRHNVIRTG 358          

HSP 2 Score: 23.0978 bits (48), Expect = 5.149e-99
Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 1
Query:  880 KAIRDGAIDA 909
            KAIRDGAIDA
Sbjct:  395 KAIRDGAIDA 404          
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSMD3_DICDI (26S proteasome non-ATPase regulatory subunit 3 OS=Dictyostelium discoideum GN=psmD3 PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 8.375e-45
Identity = 102/234 (43.59%), Postives = 144/234 (61.54%), Query Frame = 3
Query:   42 ELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPV-AALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXI 740
            E+E Y +LLVLI+LID+K+Y +A  CSSA +  +++  R T+  L+++++FYYSL YE+T +L E+R  LL+  R ATLRH++ GQ T               +QA+KL++     E+ S+ QF RY +Y G+IR IQLEY ++ + L QA RKAP   A GFR    K   IV+LL+ +IPER  F Q  ++ AL   F LT AVR+GD   F    E+ S  F SD+T T +
Sbjct:  130 EVESYIHLLVLIYLIDQKKYEDATKCSSALMETVQSNTRITLYPLSSKIFFYYSLSYEMTNNLHEVRSTLLSALRTATLRHNDEGQATIINLLLRNYLEYNLFEQADKLLANTQFPESASSNQFARYFYYQGRIRAIQLEYAESFKFLTQAIRKAPQNTAGGFRRTVYKLLSIVQLLMGEIPERNTFSQKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLV 363          
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSMD3_ANOGA (Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles gambiae GN=Dox-A2 PE=3 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 2.063e-43
Identity = 101/247 (40.89%), Postives = 143/247 (57.89%), Query Frame = 3
Query:   18 APAKHPLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAP-VAALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXIVGCXH 755
            A  K P+PE++ Y +LL+L+ L+DK    +A  CS   +A++   NRR++D++AA+ YFY+S   EL  DL  IR  L +  R ATLR+D  GQ                 DQA+KL++K+   E  SN +  R+L+YLG+I+  +LEY+ A + L+QA RKAP  AA+GFR    K  I+V LLL DIPER VF Q  + ++L   F+LT AVR+G+ + F          F  D T T I+   H
Sbjct:  117 AAIKSPVPEVDAYFHLLLLVRLLDKNDLPKATKCSQDLMAKVVGQNRRSLDLIAAKSYFYHSRVAELNNDLESIRSFLHSRLRTATLRNDFEGQAVLINCLLRNYLHYSLYDQADKLVNKSVFPETASNNECARFLYYLGRIKAAKLEYSVAHKQLVQALRKAPQQAAVGFRQTVQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRMGNLQRFGEVLVNFGEQFRQDHTFTLIIRLRH 363          
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSMD3_HUMAN (26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens GN=PSMD3 PE=1 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 3.519e-43
Identity = 97/247 (39.27%), Postives = 144/247 (58.30%), Query Frame = 3
Query:   36 LPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPV-AALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXIVGCXHMSLXLG 773
            LPE+E Y  LLV+IF+++ KRY EA+  S   + ++   NRR +D++AA+ Y+Y++  YE    L  +R  L A  R ATLRHD  GQ T               DQAEKL+SK+   E  +N ++ RYL+Y G+I+ IQLEY++A+ ++  A RKAP   A+GF+   +K  I+V LLL +IP+R  F Q  ++++L   F LT AVR G+   F    ++    F +D T+T I+   H  +  G
Sbjct:  160 LPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTG 406          
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSMD3_BOVIN (26S proteasome non-ATPase regulatory subunit 3 OS=Bos taurus GN=PSMD3 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 4.596e-43
Identity = 97/247 (39.27%), Postives = 144/247 (58.30%), Query Frame = 3
Query:   36 LPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPV-AALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXIVGCXHMSLXLG 773
            LPE+E Y  LL++IFL++ KRY EA+  S   + ++   NRR +D++AA+ Y+Y++  YE    L  +R  L A  R ATLRHD  GQ T               DQAEKL+SK+   E  +N ++ RYL+Y G+I+ IQLEY++A+ ++  A RKAP   A+GF+   +K  I+V LLL +IP+R  F Q  ++++L   F LT AVR G+   F    ++    F +D T+T I+   H  +  G
Sbjct:  160 LPEVEAYLQLLMVIFLMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDTDGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTG 406          
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSMD3_DROME (Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Drosophila melanogaster GN=Rpn3 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 6.002e-43
Identity = 100/244 (40.98%), Postives = 142/244 (58.20%), Query Frame = 3
Query:   27 KHPLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPV-AALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXIVGCXH 755
            K P+ E++ Y YLL+L+ LID      A   + A +A++   NRRT+D++ A+ YFY+S   EL   L  IR  L A  R ATLR+D  GQ                 DQA+KL+ K+   E+ SN ++ R+L+YLG+I+  +LEY+DA + L+QA RK+P  AA+GFR    K  I+V LLL +IPER VF Q G+ ++L A F+LT AVR+G+ + F     +    F  D T T I+   H
Sbjct:  118 KAPIAEVDAYFYLLLLVKLIDASDLKRAGISADALMAKISIQNRRTLDLIGAKSYFYFSRVAELKNSLEGIRSFLHARLRTATLRNDFEGQAVLINCLLRNYLHYALYDQADKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQTVQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQLDHTFTLIIRLRH 361          
BLAST of EY659643 vs. ExPASy Swiss-Prot
Match: PSMD3_MOUSE (26S proteasome non-ATPase regulatory subunit 3 OS=Mus musculus GN=Psmd3 PE=2 SV=2)

HSP 1 Score: 173.326 bits (438), Expect = 1.746e-42
Identity = 96/247 (38.87%), Postives = 143/247 (57.89%), Query Frame = 3
Query:   36 LPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETXXXXXXXXXXXXXXXDQAEKLMSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPV-AALGFRVQCNKWAIIVRLLLXDIPERTVFMQIGMEKALXAIFELTNAVRIGDXELFKSXAEKVSSTFSSDRTHTXIVGCXHMSLXLG 773
            LPE+E Y  LL++IFL++ KRY EA+  S   + ++   N R +D++AA+ Y+Y++  YE    L  +R  L A  R ATLRHD  GQ T               DQAEKL+SK+   E  +N ++ RYL+Y G+I+ IQLEY++A+ ++  A RKAP   A+GF+   +K  I+V LLL +IP+R  F Q  ++++L   F LT AVR G+   F    ++    F +D T+T I+   H  +  G
Sbjct:  156 LPEVEAYLQLLMVIFLMNSKRYKEAQKISDDLMQKISTQNHRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTG 402          
The following BLAST results are available for this feature:
BLAST of EY659643 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
PSMD3_TOBAC3.690e-10970.38Probable 26S proteasome non-ATPase regulatory subu... [more]
PSMD3_DAUCA7.695e-10768.30Probable 26S proteasome non-ATPase regulatory subu... [more]
PSD31_ARATH1.934e-10172.76Probable 26S proteasome non-ATPase regulatory subu... [more]
PSD32_ARATH5.149e-9971.60Probable 26S proteasome non-ATPase regulatory subu... [more]
PSMD3_DICDI8.375e-4543.5926S proteasome non-ATPase regulatory subunit 3 OS=... [more]
PSMD3_ANOGA2.063e-4340.89Probable 26S proteasome non-ATPase regulatory subu... [more]
PSMD3_HUMAN3.519e-4339.2726S proteasome non-ATPase regulatory subunit 3 OS=... [more]
PSMD3_BOVIN4.596e-4339.2726S proteasome non-ATPase regulatory subunit 3 OS=... [more]
PSMD3_DROME6.002e-4340.98Probable 26S proteasome non-ATPase regulatory subu... [more]
PSMD3_MOUSE1.746e-4238.8726S proteasome non-ATPase regulatory subunit 3 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-E04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659643 ID=EY659643|Name=EY659643|organism=Citrus sinensis|type=EST|length=939bp
CATCATCTGGAGCTCCAGCCCCTGCAAAACATCCTTTGCCGGAGTTAGAG
ATTTACTGCTACTTGCTTGTGCTTATATTTTTGATTGATAAGAAGAGATA
CAATGAGGCTAAAGCTTGTTCATCGGCAAGCATTGCACGGTTGAAGAACA
TGAATAGGAGAACTGTTGATGTATTAGCTGCCAGACTTTACTTCTATTAC
TCTCTTTGCTATGAACTCACTGGTGATCTTGCTGAAATTAGAGGGAATCT
ACTTGCCCTCCACCGAATTGCAACATTGCGCCATGATGAGCTGGGGCAGG
AAACACTTCTCAACCTGCTACTTCGCAATTACCTCCATTACAATTTGTAT
GATCAAGCTGAGAAACTTATGTCAAAGGCACCTCGATTTGAAGCTCACTC
AAACCAGCAGTTTTGTCGATACCTCTTTTACTTGGGAAAGATTAGGACAA
TACAGCTGGAGTACACAGATGCCAAAGAATCCCTCCTTCAAGCTGCTCGG
AAAGCCCCCGTTGCAGCCCTTGGCTTCCGAGTTCAATGCAACAAGTGGGC
AATCATTGTCCGATTATTGCTANGAGATATTCCTGAGAGGACTGTCTTTA
TGCAGATAGGCATGGAGAAGGCTTTGANGGCCATATTTGAGCTTACGAAT
GCTGTGCGCATTGGGGATNNTGAGCTATTTAAGTCAGNTGCTGAGAAAGT
CTCAAGTACTTTCAGCTCTGACCGAACCCATACTNNGATTGTAGGCTGCN
NGCATATGTCATTANGACTGGGNTGCNGGACATCAGCATCTCGTATTCTC
GCATCTCACTTTGCTGATGTGNCAAGAAGCTGAGATGGNACTCTGGNCAT
CCTGTTGCTGATGCTGAAATAATTGNTTCAAGGCAATTCGAGATGGTGCG
ATTGATGCACAGTGGATCATGCAATGGGCTGGATGTGTC
back to top