EY659633

Overview
NameEY659633
Unique NameEY659633
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length916
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3031 contig Csv1_Contig3031:28..944. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 14338_ARATH (14-3-3-like protein GF14 kappa OS=Arabidopsis thaliana GN=GRF8 PE=2 SV=2)

HSP 1 Score: 398.282 bits (1022), Expect = 3.232e-110
Identity = 200/236 (84.75%), Postives = 220/236 (93.22%), Query Frame = 3
Query:   33 TPTREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            T +R+QYVY+AKLAEQAERYEEMV+FM+ LV+ +TPA ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEE RKNEEHVSLVKDYRSKVE+ELS +C  IL+LLDSHL+PSATA ESKVFYLKMKGDY+RYLAEFK GDERK AAE+TM++YKAAQD+A+ DLAPTHPIRLGLALNFSVFYYEILNSSEKAC+MAKQAF EAIAELDTLGEE  +DSTLIM LLRDNLTLWTS
Sbjct:    4 TLSRDQYVYMAKLAEQAERYEEMVQFMEQLVSGATPAGELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNEEHVSLVKDYRSKVETELSSICSGILRLLDSHLIPSATASESKVFYLKMKGDYHRYLAEFKSGDERKTAAEDTMIAYKAAQDVAVADLAPTHPIRLGLALNFSVFYYEILNSSEKACSMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS 239          
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 14336_ARATH (14-3-3-like protein GF14 lambda OS=Arabidopsis thaliana GN=GRF6 PE=1 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 2.736e-109
Identity = 200/233 (85.84%), Postives = 215/233 (92.27%), Query Frame = 3
Query:   42 REQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            R+QYVY+AKLAEQAERYEEMV+FM+ LVT +TPA ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEE RKN+EHVSLVKDYRSKVESELS VC  ILKLLDSHL+PSA A ESKVFYLKMKGDY+RY+AEFK GDERK AAE+TML+YKAAQDIA  D+APTHPIRLGLALNFSVFYYEILNSS+KAC MAKQAF EAIAELDTLGEE  +DSTLIM LLRDNLTLWTS
Sbjct:    7 RDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMKGDYHRYMAEFKSGDERKTAAEDTMLAYKAAQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDKACNMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS 239          
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 1433D_TOBAC (14-3-3-like protein D OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 5.159e-108
Identity = 202/234 (86.32%), Postives = 217/234 (92.74%), Query Frame = 3
Query:   39 TREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            TREQ +YLAKLAEQAERYEEMVKFMD LV  S  ++ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEEGRKNEEHV LVKDYRSKVESELSDVC  ILK+LD +L+PSA AGESKVFYLKMKGDYYRYLAEFKVG+ERK AAE+TML+YKAAQDIAL +LAPTHPIRLGLALN+SVFYYEILN+SEKAC+MAKQAF EAIAELDTLGEE  +DSTLIM LLRDNLTLWTS
Sbjct:    8 TREQCLYLAKLAEQAERYEEMVKFMDRLVAVSA-SSELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNEEHVVLVKDYRSKVESELSDVCAGILKILDQYLIPSAAAGESKVFYLKMKGDYYRYLAEFKVGNERKEAAEDTMLAYKAAQDIALAELAPTHPIRLGLALNYSVFYYEILNASEKACSMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS 240          
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 14331_SOLLC (14-3-3 protein 1 OS=Solanum lycopersicum GN=TFT1 PE=3 SV=2)

HSP 1 Score: 389.423 bits (999), Expect = 1.501e-107
Identity = 200/234 (85.47%), Postives = 218/234 (93.16%), Query Frame = 3
Query:   39 TREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            TREQ +YLAKLAEQAERYEEMVKFMD LV  S  ++ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEEGRKN+EHV LVKDYRSKVESELSDVC  ILK+LD +L+PSA+AGESKVFYLKMKGDYYRYLAEFKVG+ERK AAE+TML+YKAAQDIA+ +LAPTHPIRLGLALNFSVFYYEILN+SEKAC+MAKQAF EAIAELDT+GEE  +DSTLIM LLRDNLTLWTS
Sbjct:    8 TREQCLYLAKLAEQAERYEEMVKFMDKLVIGSG-SSELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNDEHVVLVKDYRSKVESELSDVCAGILKILDQYLIPSASAGESKVFYLKMKGDYYRYLAEFKVGNERKEAAEDTMLAYKAAQDIAVAELAPTHPIRLGLALNFSVFYYEILNASEKACSMAKQAFEEAIAELDTMGEESYKDSTLIMQLLRDNLTLWTS 240          
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 14310_SOLLC (14-3-3 protein 10 OS=Solanum lycopersicum GN=TFT10 PE=2 SV=2)

HSP 1 Score: 388.267 bits (996), Expect = 3.344e-107
Identity = 199/234 (85.04%), Postives = 215/234 (91.88%), Query Frame = 3
Query:   39 TREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            +REQ +YLAKLAEQAERYEEMV+FMD LV +STPA ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEE RKNEEHV LVK+YR KVE+ELS VC  ILKLL+S+LVPSAT  ESKVFYLKMKGDYYRYLAEFK+GDERK AAE+TM SYKAAQ+IALTDL PTHPIRLGLALNFSVFY+EILNSS+KAC+MAKQAF EAIAELDTLGEE  +DSTLIM LLRDNLTLWTS
Sbjct:   10 SREQCLYLAKLAEQAERYEEMVQFMDKLVLNSTPAGELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNEEHVHLVKEYRGKVENELSQVCAGILKLLESNLVPSATTSESKVFYLKMKGDYYRYLAEFKIGDERKQAAEDTMNSYKAAQEIALTDLPPTHPIRLGLALNFSVFYFEILNSSDKACSMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS 243          
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 1433B_SOYBN (14-3-3-like protein B (Fragment) OS=Glycine max GN=GF14B PE=2 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 6.307e-106
Identity = 195/233 (83.69%), Postives = 212/233 (90.99%), Query Frame = 3
Query:   42 REQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            REQYVYLA ++EQAERYEEMV+FM  +V  STPA+ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEEGRKN++HVSLVK YRSKVE+EL+ VC +IL LLDS+LVPSA+A ESKVFYLKMKGDY+RYLAEFKVGDERK A E+TMLSYKAAQDIA  DL PTHPIRLGLALNFSVFYYEILN S+KAC MAKQAF EAIAELDTLGEE  +DSTLIM LLRDNLTLWTS
Sbjct:    6 REQYVYLANVSEQAERYEEMVEFMQKVVVGSTPASELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNDDHVSLVKHYRSKVENELTQVCATILSLLDSNLVPSASASESKVFYLKMKGDYHRYLAEFKVGDERKTATEDTMLSYKAAQDIASADLPPTHPIRLGLALNFSVFYYEILNQSDKACAMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS 238          
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 14333_ORYSJ (14-3-3-like protein GF14-C OS=Oryza sativa subsp. japonica GN=GF14C PE=1 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.965e-99
Identity = 183/234 (78.21%), Postives = 208/234 (88.89%), Query Frame = 3
Query:   39 TREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            +RE+ VY+AKLAEQAERYEEMV++M+  V  +    ELTVEERNLLSVAYKNVIG+ RA+WRI+SSIEQKEEGR NEEHV+L+K+YR K+E+ELS +C  ILKLLDSHLVPS+TA ESKVFYLKMKGDY+RYLAEFK G ERK AAE+TM++YKAAQDIAL DLAPTHPIRLGLALNFSVFYYEILNS +KAC +AKQAF EAI+ELDTLGEE  +DSTLIM LLRDNLTLWTS
Sbjct:    2 SREENVYMAKLAEQAERYEEMVEYMEK-VAKTVDVEELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEEGRGNEEHVTLIKEYRGKIEAELSKICDGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTMVAYKAAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTS 234          
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 1433_LILLO (14-3-3-like protein OS=Lilium longiflorum PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 2.173e-98
Identity = 182/235 (77.45%), Postives = 208/235 (88.51%), Query Frame = 3
Query:   36 PTREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            P+RE+ VY+AKLAEQAERYEEMV+FM+  V  +    ELTVEERNLLSVAYKNVIG+ RA+WRIISSIEQKEE R NE+HV+L+KDYR K+E+ELS +C  ILKLLDSHLVPS+TA ESKVFYLKMKGDY+RYLAEFK G ERK AAE+T+L+YK+AQDIAL +LAPTHPIRLGLALNFSVFYYEILNS ++AC +AKQAF EAI+ELDTLGEE  +DSTLIM LLRDNLTLWTS
Sbjct:    6 PSREENVYMAKLAEQAERYEEMVEFMEK-VARTVDTEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVALIKDYRGKIEAELSKICDGILKLLDSHLVPSSTAPESKVFYLKMKGDYHRYLAEFKSGAERKEAAESTLLAYKSAQDIALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTS 239          
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 1433_HELAN (14-3-3-like protein OS=Helianthus annuus PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 8.256e-98
Identity = 180/239 (75.31%), Postives = 206/239 (86.19%), Query Frame = 3
Query:   24 AMGTPTREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            A  +  RE+ VYLAKLAEQAERYEEMV+FM+ +V ++    ELT+EERNLLSVAYKNVIG+ RA+WRIISSIEQKEE R NE HVS ++DYRSK+ESELS +C  ILK+LDS L+ SA+ G+SKVFYLKMKGDYYRYLAEFK GDERK AAENT+ +YKAAQDIA  +LAPTHPIRLGLALNFSVFYYEILNS ++AC +AKQAF EAIAELDTLGE+  +DSTLIM LLRDNLTLWTS
Sbjct:    2 AAASSPREENVYLAKLAEQAERYEEMVEFMEKVVAAADGGEELTIEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEGHVSTIRDYRSKIESELSSICDGILKVLDSKLIGSASGGDSKVFYLKMKGDYYRYLAEFKTGDERKLAAENTLSAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTS 240          
BLAST of EY659633 vs. ExPASy Swiss-Prot
Match: 14332_SOLLC (14-3-3 protein 2 OS=Solanum lycopersicum GN=TFT2 PE=3 SV=2)

HSP 1 Score: 356.681 bits (914), Expect = 1.078e-97
Identity = 182/233 (78.11%), Postives = 208/233 (89.27%), Query Frame = 3
Query:   42 REQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAF*EAIAELDTLGEEILQDSTLIMXLLRDNLTLWTS 740
            RE+ VY+AKLAEQAERYEEMV+FM+  V++S  + ELTVEERNLLSVAYKNVIG+ RA+WRIISSIEQKEE R NEEHV  +K+YRSK+ESELSD+C  ILKLLDS+L+PSA+ G+SKVFYLKMKGDY+RYLAEFK G ERK AAE+T+ +YKAAQDIA T+LAPTHPIRLGLALNFSVFYYEILNS ++AC +AKQAF EAIAELDTLGEE  +DSTLIM LLRDNLTLWTS
Sbjct:    3 REENVYMAKLAEQAERYEEMVQFMEK-VSTSLGSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEEHVKCIKEYRSKIESELSDICDGILKLLDSNLIPSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQDIANTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS 234          
The following BLAST results are available for this feature:
BLAST of EY659633 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 143
Match NameE-valueIdentityDescription
14338_ARATH3.232e-11084.7514-3-3-like protein GF14 kappa OS=Arabidopsis thal... [more]
14336_ARATH2.736e-10985.8414-3-3-like protein GF14 lambda OS=Arabidopsis tha... [more]
1433D_TOBAC5.159e-10886.3214-3-3-like protein D OS=Nicotiana tabacum PE=2 SV... [more]
14331_SOLLC1.501e-10785.4714-3-3 protein 1 OS=Solanum lycopersicum GN=TFT1 P... [more]
14310_SOLLC3.344e-10785.0414-3-3 protein 10 OS=Solanum lycopersicum GN=TFT10... [more]
1433B_SOYBN6.307e-10683.6914-3-3-like protein B (Fragment) OS=Glycine max GN... [more]
14333_ORYSJ1.965e-9978.2114-3-3-like protein GF14-C OS=Oryza sativa subsp. ... [more]
1433_LILLO2.173e-9877.4514-3-3-like protein OS=Lilium longiflorum PE=2 SV=... [more]
1433_HELAN8.256e-9875.3114-3-3-like protein OS=Helianthus annuus PE=2 SV=1[more]
14332_SOLLC1.078e-9778.1114-3-3 protein 2 OS=Solanum lycopersicum GN=TFT2 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-D04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659633 ID=EY659633|Name=EY659633|organism=Citrus sinensis|type=EST|length=916bp
AACTTTACAGTTTCTGCAATTCTGCTATGGGAACCCCGACGAGAGAGCAA
TACGTTTACCTGGCGAAACTCGCCGAGCAAGCCGAGCGCTATGAAGAGAT
GGTTAAGTTCATGGACAGCCTCGTCACTTCCTCCACTCCGGCGACTGAAC
TCACCGTCGAGGAGCGCAACCTCCTCTCCGTTGCTTACAAGAACGTCATC
GGCTCTCTTCGCGCCGCGTGGCGTATTATCTCCTCTATCGAGCAGAAAGA
GGAAGGCCGCAAGAACGAGGAACACGTCTCGCTGGTCAAAGACTATCGGT
CAAAGGTAGAGTCTGAGTTATCTGACGTGTGCGGGAGCATATTGAAGTTG
CTGGACTCGCACCTTGTGCCTTCGGCTACTGCTGGTGAGTCCAAAGTCTT
CTATTTGAAGATGAAGGGAGATTACTACCGTTACTTGGCGGAGTTTAAAG
TTGGTGATGAGAGGAAGGCCGCCGCTGAAAACACTATGTTGTCTTATAAG
GCGGCTCAGGATATTGCACTGACTGATCTGGCGCCAACACACCCTATAAG
GTTGGGGCTGGCACTCAACTTCTCAGTGTTTTACTATGAGATTCTCAATT
CATCAGAGAAAGCTTGTACCATGGCCAAACAGGCCTTTTGAGAGGCCATT
GCTGAGCTGGACACTTTGGGTGAAGAAATCCTACAGGATAGCACTCTTAT
CATGCNATTGCTAAGAGACAACCTCACTCTGTGGACCTCANATTGCAGGA
GCANATAGATGAGGCATAGGGGTATGAATCGNTTGCTNCTCTGGGGAGGT
GGGCTCTTGAATGTCATGAATTGTAAAGCAAGGGGGAATTTAGTTGACAT
GTATCGGGTGGAAACTGGGGGTGGCTCCCTTTGGGATTCGNTACATATTC
TGACAACTTTTGGCAG
back to top