EY659621

Overview
NameEY659621
Unique NameEY659621
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length888
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7118 contig Csv1_Contig7118:23..856. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: AB19A_PRUPE (Auxin-binding protein ABP19a OS=Prunus persica GN=ABP19A PE=3 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.773e-73
Identity = 136/193 (70.47%), Postives = 156/193 (80.83%), Query Frame = 1
Query:   76 NAMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILGGT 654
            +A V DFCVAD K  D PAGY C  PA VT +DFV+SGLG+AGNTT+II AAVTPAF AQFP VNGLG+SLARLDL  GGVIP HTHP ASE+LLVV G I AGF++S  NT Y+KTLKKGDIM+FPQGLLHFQVN G   AL F SF+SP+PGLQI DFALF N+L ++L+ QTTFLD A +K+LK +LGGT
Sbjct:   17 HASVQDFCVADYKAPDGPAGYSCKKPAKVTINDFVYSGLGIAGNTTNIIKAAVTPAFAAQFPGVNGLGISLARLDLGPGGVIPFHTHPGASEVLLVVQGTIIAGFVASD-NTPYLKTLKKGDIMVFPQGLLHFQVNGGGTPALAFPSFSSPSPGLQILDFALFKNDLPTELIAQTTFLDAAQIKKLKGVLGGT 208          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL31_ARATH (Germin-like protein subfamily 3 member 1 OS=Arabidopsis thaliana GN=GLP1 PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.561e-72
Identity = 135/194 (69.59%), Postives = 157/194 (80.93%), Query Frame = 1
Query:   76 NAMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILGGTG 657
            NA V DFCVA+LK +++PAGYPC+ P  V A DFVFSGLG  GNTT+IINAAVTPAF AQFP +NGLGLS ARLDLA  GVIP+HTHP ASE+L V+ G ITAGF+ SSAN VYV+TLK G +M+FPQGLLHFQ+N+G   A   V+FNS NPGLQI DFALFAN+L ++LV  TTFLD  TVK+LK +LGGTG
Sbjct:   16 NASVQDFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLNGLGLSTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFV-SSANAVYVQTLKPGQVMVFPQGLLHFQINAGKSSASAVVTFNSANPGLQILDFALFANSLPTELVVGTTFLDATTVKKLKGVLGGTG 208          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: AB19B_PRUPE (Auxin-binding protein ABP19b OS=Prunus persica GN=ABP19B PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 2.168e-71
Identity = 130/193 (67.36%), Postives = 155/193 (80.31%), Query Frame = 1
Query:   76 NAMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILGGT 654
            +A V DFCVAD K  D PAGY C  PA+VT +DFV+SGLG+AGNTT+I  AAVTPAF AQFP VNGLG+SLARLDL  GGV+P HTHP ASE+LLVV G I AGF++S  NT Y+KTLKKGDI++FPQGLLHFQVN G   A+ F SF+SP+PGLQI DFALF N+L+++L+ QTT LD   +K+LK +LGGT
Sbjct:   17 HASVQDFCVADYKAPDGPAGYSCKKPAIVTVNDFVYSGLGIAGNTTNIFKAAVTPAFAAQFPGVNGLGISLARLDLGPGGVVPFHTHPGASEVLLVVQGTIIAGFVASD-NTPYLKTLKKGDIIVFPQGLLHFQVNGGDTPAIAFPSFSSPSPGLQIVDFALFKNDLATELIAQTTLLDAPQIKKLKGVLGGT 208          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL814_ORYSJ (Germin-like protein 8-14 OS=Oryza sativa subsp. japonica GN=GER5 PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.405e-70
Identity = 127/193 (65.80%), Postives = 155/193 (80.31%), Query Frame = 1
Query:   79 AMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILGGTG 657
            A+  DFCVADL  SD+PAGYPC   A V A DF + GL  AGNT+++I AAVTPAFV QFP VNGLG+S ARLD+A GGV+P+HTHPAASE+L V  G + AGFI+SS+NTVY +TL  GDIM+FPQGLLH+Q N+G   A+  V+F+ PNPGLQITD+ALFANNL S +VE+ TFLDDA VK+LK++LGG+G
Sbjct:   23 ALTQDFCVADLTCSDTPAGYPC--KASVGAGDFAYHGLAAAGNTSNLIKAAVTPAFVGQFPGVNGLGISAARLDIAVGGVVPLHTHPAASELLFVTQGTVAAGFITSSSNTVYTRTLYAGDIMVFPQGLLHYQYNAGQSAAVALVAFSGPNPGLQITDYALFANNLPSAIVEKVTFLDDAQVKKLKSVLGGSG 213          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: ABP20_PRUPE (Auxin-binding protein ABP20 OS=Prunus persica GN=ABP20 PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 9.107e-70
Identity = 128/193 (66.32%), Postives = 154/193 (79.79%), Query Frame = 1
Query:   76 NAMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILGGT 654
            NA V DFCVADL   + PAG+ C  PA V  +DFVFSGLG+AGNT++II AAVTPAFVAQFP VNGLG+S+ARLDLA GGV+P HTHP ASE+L+V  G I AGF++S  NT Y++TL+KGDIM+FPQGLLHFQVN G   AL F SF S +PGLQI DFALF N+L ++++ QTTFLD A +K+LK +LGGT
Sbjct:   22 NAAVQDFCVADLAAPEGPAGFSCKKPASVKVNDFVFSGLGIAGNTSNIIKAAVTPAFVAQFPGVNGLGISIARLDLAVGGVVPFHTHPGASEVLIVAQGTICAGFVASD-NTPYLQTLEKGDIMVFPQGLLHFQVNGGEAPALAFASFGSASPGLQILDFALFKNDLPTEVIAQTTFLDAAQIKKLKGVLGGT 213          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GLP1_BRANA (Germin-like protein 1 OS=Brassica napus GN=GER1 PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 1.315e-68
Identity = 132/194 (68.04%), Postives = 156/194 (80.41%), Query Frame = 1
Query:   76 NAMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILGGTG 657
            N  V DFCVA+LK +++PAGYPC+ P  V A DFVFS LG  GNTT+II+AAVTP FVAQFPA+NGLG+S ARLDLA  GVIP+HTHP ASE+L V+ G ITAGFISS AN+VYV+TLK G +M+FPQGLLHFQ+N+G   A   V+F+S +PGLQI DFALFAN LS++LV  TTFL  ATVK LK +LGGTG
Sbjct:   16 NDSVQDFCVANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVTPGFVAQFPALNGLGISTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFISS-ANSVYVQTLKPGQVMVFPQGLLHFQINAGKTPAAALVTFSSASPGLQILDFALFANTLSTELVSATTFLPPATVKTLKGVLGGTG 207          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL33_ARATH (Germin-like protein subfamily 3 member 3 OS=Arabidopsis thaliana GN=GER3 PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 9.425e-67
Identity = 128/192 (66.67%), Postives = 150/192 (78.12%), Query Frame = 1
Query:   79 AMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILGGT 654
            A V DFCVAD K   SP+GY C  P  VT +DF F+GLG AGNT++II AAVTPAF   +  +NGLG+SLARLDLA GGVIP+HTHP ASE+L+V+ G I AGFI SSAN VY+KTL +GD M+FPQGLLHFQ+NSG   AL FV+F S +PGLQI  FALFAN+L S+LVE TTFL DA VK+LK +LGGT
Sbjct:   20 ASVQDFCVADPKGPQSPSGYSCKNPDQVTENDFAFTGLGTAGNTSNIIKAAVTPAFAPAYAGINGLGVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFI-SSANKVYLKTLNRGDSMVFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDAEVKKLKGVLGGT 210          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GLP1_SINAL (Germin-like protein 1 OS=Sinapis alba GN=GLP1 PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 3.960e-65
Identity = 126/192 (65.62%), Postives = 148/192 (77.08%), Query Frame = 1
Query:   79 AMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILGGT 654
            A V DFCVAD K   +P+GY C  P  VT +DF FSGLG AGNT+++I AAVTPAF   F  +NGL +SLARLDLA GGVIP+HTHP ASE+L+V+ G I AGFI SSAN VY+KTL +GD M+FPQGLLHFQ+NSG   AL FV+F S +PGLQI  FALFAN+L S+LVE TTFL D  VK+LK +LGGT
Sbjct:   20 ASVQDFCVADPKGPQNPSGYSCKNPDQVTENDFAFSGLGKAGNTSNVIKAAVTPAFAPAFAGLNGLDVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFI-SSANKVYLKTLSRGDSMVFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEVKKLKGVLGGT 210          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL813_ORYSJ (Germin-like protein 8-13 OS=Oryza sativa subsp. japonica GN=Os08g0459700 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.477e-53
Identity = 104/194 (53.61%), Postives = 136/194 (70.10%), Query Frame = 1
Query:   79 AMVNDFCVADLKL-SDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILGGTG 657
            A+  DFCVA+L L +D+P+GY C P A VTA DF    L   G      N ++  AFV Q+PAVNGLG+S +R+D+  GGV+P+HTHPA SE+L V+ G + AGFISSS N VY K + KG + +FPQGLLHFQ N+G   A+ F +++S NPGLQI D+ALFANNL +  V + TFL +A V+RLK+  GG+G
Sbjct:   26 ALTQDFCVANLPLGADTPSGYQCRPAATVTAADFYSGALARPGILIRPFNTSLASAFVQQYPAVNGLGISASRVDILPGGVVPLHTHPAGSELLYVLDGALVAGFISSSDNKVYYKEVSKGGMFVFPQGLLHFQYNTGDTTAVAFAAYSSSNPGLQILDYALFANNLPTSYVVKGTFLAEAEVRRLKSKFGGSG 219          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GLP1_IPONI (Germin-like protein OS=Ipomoea nil GN=GLP PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.237e-50
Identity = 115/195 (58.97%), Postives = 134/195 (68.72%), Query Frame = 1
Query:   76 NAMVNDFCVADLK-LSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFA-LFANNLSSQLVEQTTFLDDATVKRLKAILGGT 654
            NA VNDFCVA+     D+P+G+ C   A VTA DFV+SGL   GNTT+IINAAVTPAFV QFP V GLG++LARLDLA GGVIP+HTHP ASEIL VV G I A FI SS N VY K L  GD+M+FPQGLL FQ  +G   A G       NPGLQI +F   F      + +  TT LD+AT+K+LK+ LGGT
Sbjct:   21 NASVNDFCVANGPGARDTPSGFVCKNTAKVTAADFVYSGLAKPGNTTNIINAAVTPAFVGQFPGVIGLGVTLARLDLAPGGVIPMHTHPGASEILNVVEGTILAAFI-SSGNKVYEKALYPGDVMVFPQGLLDFQEITGKI-APGLCELRQRNPGLQILEFQHCFPTIFPPKTIAGTTCLDEATIKKLKSGLGGT 213          
The following BLAST results are available for this feature:
BLAST of EY659621 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
AB19A_PRUPE1.773e-7370.47Auxin-binding protein ABP19a OS=Prunus persica GN=... [more]
GL31_ARATH2.561e-7269.59Germin-like protein subfamily 3 member 1 OS=Arabid... [more]
AB19B_PRUPE2.168e-7167.36Auxin-binding protein ABP19b OS=Prunus persica GN=... [more]
GL814_ORYSJ1.405e-7065.80Germin-like protein 8-14 OS=Oryza sativa subsp. ja... [more]
ABP20_PRUPE9.107e-7066.32Auxin-binding protein ABP20 OS=Prunus persica GN=A... [more]
GLP1_BRANA1.315e-6868.04Germin-like protein 1 OS=Brassica napus GN=GER1 PE... [more]
GL33_ARATH9.425e-6766.67Germin-like protein subfamily 3 member 3 OS=Arabid... [more]
GLP1_SINAL3.960e-6565.63Germin-like protein 1 OS=Sinapis alba GN=GLP1 PE=2... [more]
GL813_ORYSJ3.477e-5353.61Germin-like protein 8-13 OS=Oryza sativa subsp. ja... [more]
GLP1_IPONI1.237e-5058.97Germin-like protein OS=Ipomoea nil GN=GLP PE=2 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659621 ID=EY659621|Name=EY659621|organism=Citrus sinensis|type=EST|length=888bp
AAATAACTTCACTAAATATTAGTCAAAATGCTTCACATTCTCTTCTTCTT
CCTTGCTTTCGTATCCTCTTCCTCCAATGCTATGGTTAACGACTTCTGCG
TCGCTGACCTAAAGCTGTCGGATAGTCCCGCCGGCTATCCTTGCGTGCCC
CCCGCTATGGTTACCGCTGACGACTTCGTATTTTCGGGCCTCGGCGTGGC
CGGAAACACCACGAGCATTATCAACGCGGCAGTGACACCTGCATTTGTAG
CTCAATTTCCGGCCGTGAATGGGCTCGGACTCTCCTTGGCACGCCTAGAT
CTTGCAAAGGGTGGCGTAATCCCAATCCACACTCATCCAGCTGCTTCCGA
AATCCTTCTTGTTGTGCATGGCTGCATAACTGCCGGGTTCATTTCCTCTT
CAGCTAACACTGTTTACGTAAAGACGCTTAAGAAGGGAGATATCATGATC
TTTCCACAAGGGTTGTTGCATTTTCAAGTAAATTCCGGTGCGGACGGAGC
CCTCGGTTTTGTTAGCTTCAACAGCCCGAATCCTGGACTCCAAATCACCG
ATTTCGCCTTATTTGCTAACAACTTGTCTTCCCAATTGGTGGAGCAGACC
ACTTTCCTTGACGATGCTACGGTGAAGAGGCTCAAGGCTATCCTTGGTGG
CACCGGCTAGGCTTATTAGNTACCACATTCTTCATTTGTAGGTTTGAGTT
CTTTATTTCATTTAGTTGCCTATGTTCTTGATCGTTGGAATTCACGAGTT
AGTATTTTCTGGTCTCACTGCCCCTATCTTTTCTTCTGAATAATAAAATG
CCTCTCATCATGCAAAAAAAAAAAAATAATGGCCGNCCGTCTAGAAGTAT
CAAACTTACGTACCGCTGCATGCGGAGTTATAACTCTT
back to top