EY659562

Overview
NameEY659562
Unique NameEY659562
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length955
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7563 contig Csv1_Contig7563:162..1116. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659562 vs. ExPASy Swiss-Prot
Match: LBD37_ARATH (LOB domain-containing protein 37 OS=Arabidopsis thaliana GN=LBD37 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.197e-56
Identity = 121/221 (54.75%), Postives = 134/221 (60.63%), Query Frame = 2
Query:  113 HATVFVAKFFGRAGLMSFISAVPESQRPALFQSLLYEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLRGGTLRPVPELLNSCGGSPTLTSDDVSEAEVTCTDMSRLQDXXXXXXXXXXXXXXXXXXXXXXXXXEE-------SAMKLQQSDLDLRLTPRFTGK--VPPEVRRRPGTPSMNSEESGTTT-----CFESGLTDHRYLNGAXE-RKLLNLFV 730
            HATVFVAKFFGRAGLMSFISAVP+SQRPALFQSLLYEACGRTVNPVNGA+G+LWTGNW++CQAAVETVLRGG+LRP+PELL   GG     S    EA   CT+M  LQ                                   S+     S+LDL L P F  K   P   RRR  TPSMNSE+SGTTT     C +  +    Y NG  E  KLLNLFV
Sbjct:   34 HATVFVAKFFGRAGLMSFISAVPDSQRPALFQSLLYEACGRTVNPVNGAIGMLWTGNWNICQAAVETVLRGGSLRPIPELLTHGGGFAGFPSPTSEEASEICTEMLNLQQNDSTDRNIYHHSRFSSSRSRSTMDSSSPTKRKRLSSEDQPSSELDLSLIPNFPIKQATPSSTRRRSVTPSMNSEDSGTTTTTTAFCDKGDV----YGNGGGETTKLLNLFV 250          

HSP 2 Score: 39.2762 bits (90), Expect = 1.197e-56
Identity = 16/26 (61.54%), Postives = 21/26 (80.77%), Query Frame = 3
Query:   33 RVRRILCSESCILPPCLQWIESPESQ 110
            RV R  CSE+CIL PC+QWIE+ ++Q
Sbjct:    7 RVLRKGCSENCILRPCIQWIETADAQ 32          
BLAST of EY659562 vs. ExPASy Swiss-Prot
Match: LBD38_ARATH (LOB domain-containing protein 38 OS=Arabidopsis thaliana GN=LBD38 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 2.215e-55
Identity = 118/219 (53.88%), Postives = 134/219 (61.19%), Query Frame = 2
Query:  113 HATVFVAKFFGRAGLMSFISAVPESQRPALFQSLLYEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLRGGTLRPVPELLNSCG--GSPTLTSDDVSEAEVTCTDMSRLQDXXXXXXXXXXXXXXXXXXXXXXXXXEE-------SAMKLQQSDLDLRLTPRFTGKVPPEVRRRPGTPSMNSEESGTTTCFESGLTDHRYL-----NGAXERKLLNLF 727
            HATVFVAKFFGRAGLMSFISAVPESQ PALFQSLLYEACGRTVNPVNGAVGLLWTGNW+VCQAAVETVLRGG+L+P+PELLN  G  G P+ TSD+ SE    CT+M  L+                                   S+ +   S+LDL L P +  K  P    +  TPSM SEES TT  F++     RY+      G    KLLNLF
Sbjct:   34 HATVFVAKFFGRAGLMSFISAVPESQCPALFQSLLYEACGRTVNPVNGAVGLLWTGNWNVCQAAVETVLRGGSLKPIPELLNGGGFAGFPSPTSDEASE---ICTEMLNLRKADDSGDRNIYHHCRFSSSRSRSRSTASPPKRKRLSSEQQPSSELDLSLIPIYPIKTLP---FKEDTPSMYSEESVTTVSFQNNNAGDRYVRCGGGGGGATTKLLNLF 246          

HSP 2 Score: 44.669 bits (104), Expect = 2.215e-55
Identity = 19/26 (73.08%), Postives = 22/26 (84.62%), Query Frame = 3
Query:   33 RVRRILCSESCILPPCLQWIESPESQ 110
            RV R  CSE+CIL PC+QWIESPE+Q
Sbjct:    7 RVLRKGCSENCILRPCIQWIESPEAQ 32          
BLAST of EY659562 vs. ExPASy Swiss-Prot
Match: LBD39_ARATH (LOB domain-containing protein 39 OS=Arabidopsis thaliana GN=LBD39 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 8.934e-51
Identity = 110/214 (51.40%), Postives = 131/214 (61.21%), Query Frame = 2
Query:  113 HATVFVAKFFGRAGLMSFISAVPESQRPALFQSLLYEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLRGGTLRPVPELLNSCGGSPTLTSDDVSEAEVTCTDMSRLQDXXXXXXXXXXXXXXXXXXXXXXXXXEESAMKLQQSD-LDLRLTPRFTGKVPPEV------RRRPGTPSMNSEESGTTTCFESGLT-DHRYLNGAXERKLLNLFV 730
            HATVFVAKFFGRAGLMSFIS+VPE QRPALFQSLL+EACGRTVNPVNGAVG+LWT NWHVCQAAVETVLRGGTLRP+ +LL S    P+L       +E+   D+SR Q                           +S + LQ +  L L         +PP          RPG+PS   EES TT+C+E+G+  D++      E+KLLNLFV
Sbjct:   34 HATVFVAKFFGRAGLMSFISSVPELQRPALFQSLLFEACGRTVNPVNGAVGMLWTRNWHVCQAAVETVLRGGTLRPISDLLES----PSLMISCDESSEIWHQDVSRNQTHHCRFSTSRSTTEMKDSLVNRKRLKSDSDLDLQVNHGLTLTAPAVPVPFLPPSSFCKVVKGDRPGSPS---EESVTTSCWENGMRGDNKQKRNKGEKKLLNLFV 240          

HSP 2 Score: 43.5134 bits (101), Expect = 8.934e-51
Identity = 20/26 (76.92%), Postives = 21/26 (80.77%), Query Frame = 3
Query:   33 RVRRILCSESCILPPCLQWIESPESQ 110
            RV R  CSE+CIL PCLQWIES ESQ
Sbjct:    7 RVLRKGCSETCILRPCLQWIESAESQ 32          
BLAST of EY659562 vs. ExPASy Swiss-Prot
Match: LBD40_ARATH (LOB domain-containing protein 40 OS=Arabidopsis thaliana GN=LBD40 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.818e-31
Identity = 50/78 (64.10%), Postives = 67/78 (85.90%), Query Frame = 2
Query:  110 SHATVFVAKFFGRAGLMSFISAVPESQRPALFQSLLYEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLRGGTLRPV 343
            ++ATVF+AKF+GRAGLM+ ++  P+  RPA+F+SLLYEACGR VNP+ G+VGLLW+GNWH+CQAAVE V+RG  + P+
Sbjct:   35 ANATVFLAKFYGRAGLMNLLNTGPDHLRPAIFRSLLYEACGRIVNPIYGSVGLLWSGNWHLCQAAVEAVMRGSPVTPI 112          

HSP 2 Score: 40.4318 bits (93), Expect = 1.818e-31
Identity = 18/27 (66.67%), Postives = 21/27 (77.78%), Query Frame = 3
Query:   33 RVRRILCSESCILPPCLQWIESPESQA 113
            RV R  CSE+C + PCLQWI+S ESQA
Sbjct:    9 RVLRKGCSENCSIRPCLQWIKSAESQA 35          
BLAST of EY659562 vs. ExPASy Swiss-Prot
Match: LBD41_ARATH (LOB domain-containing protein 41 OS=Arabidopsis thaliana GN=LBD41 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 7.858e-29
Identity = 50/96 (52.08%), Postives = 70/96 (72.92%), Query Frame = 2
Query:  110 SHATVFVAKFFGRAGLMSFISAVPESQRPALFQSLLYEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLRGGTLRPVPELLNSCGGSPTLTSDDV 397
            ++ATVF+AKF+GRAGLM+ I+A P   RP +F+SLL+EACGR VNP+ G+VGLLW+GNW +CQ AVE V++G  ++ +     + G  P L   D+
Sbjct:   35 ANATVFLAKFYGRAGLMNLINAGPNHLRPGIFRSLLHEACGRIVNPIYGSVGLLWSGNWQLCQDAVEAVMKGEPVKEIATDAATIGQGPPLKIYDI 130          

HSP 2 Score: 39.6614 bits (91), Expect = 7.858e-29
Identity = 17/27 (62.96%), Postives = 20/27 (74.07%), Query Frame = 3
Query:   33 RVRRILCSESCILPPCLQWIESPESQA 113
            RV R  CSE C + PCL WI+SPE+QA
Sbjct:    9 RVLRKGCSEDCSIRPCLAWIKSPEAQA 35          
BLAST of EY659562 vs. ExPASy Swiss-Prot
Match: LBD42_ARATH (LOB domain-containing protein 42 OS=Arabidopsis thaliana GN=LBD42 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 4.122e-27
Identity = 47/79 (59.49%), Postives = 64/79 (81.01%), Query Frame = 2
Query:  110 SHATVFVAKFFGRAGLMSFISAVPESQRPALFQSLLYEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLRGGTLRPVP 346
            ++AT+F+AKF+GRAGL++ I + P+  RPA+F+SLLYEACGR VNPV+G+VGL+W+GNW  CQAAV+ VL G  +   P
Sbjct:   35 ANATLFLAKFYGRAGLLNLIESGPDHLRPAIFRSLLYEACGRIVNPVDGSVGLMWSGNWAQCQAAVDAVLNGLPITHTP 113          

HSP 2 Score: 36.965 bits (84), Expect = 4.122e-27
Identity = 15/27 (55.56%), Postives = 20/27 (74.07%), Query Frame = 3
Query:   33 RVRRILCSESCILPPCLQWIESPESQA 113
            RV R  C++ C + PCLQWI+S +SQA
Sbjct:    9 RVLRKGCNQDCTIRPCLQWIKSADSQA 35          
The following BLAST results are available for this feature:
BLAST of EY659562 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
LBD37_ARATH1.197e-5654.75LOB domain-containing protein 37 OS=Arabidopsis th... [more]
LBD38_ARATH2.215e-5553.88LOB domain-containing protein 38 OS=Arabidopsis th... [more]
LBD39_ARATH8.934e-5151.40LOB domain-containing protein 39 OS=Arabidopsis th... [more]
LBD40_ARATH1.818e-3164.10LOB domain-containing protein 40 OS=Arabidopsis th... [more]
LBD41_ARATH7.858e-2952.08LOB domain-containing protein 41 OS=Arabidopsis th... [more]
LBD42_ARATH4.122e-2759.49LOB domain-containing protein 42 OS=Arabidopsis th... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-011-E08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659562 ID=EY659562|Name=EY659562|organism=Citrus sinensis|type=EST|length=955bp
ANGTTTTCGGTCCGNATTCCCGCCTCGACCCACGCGTCCGGCGAATTTTA
TGCAGCGAGTCGTGTATTTTACCCCCTTGTTTACAGTGGATCGAGAGTCC
TGAATCCCAAGCCACGCTACTGTGTTCGTCGCCAAATTCTTTGGCCGTGC
TGGCCTCATGTCCTTCATCTCGGCTGTCCCTGAATCCCAGCGTCCTGCGT
TGTTTCAGTCTTTGTTGTACGAAGCCTGTGGCCGAACTGTGAATCCTGTG
AATGGAGCTGTAGGTCTTTTGTGGACGGGGAACTGGCATGTTTGCCAGGC
TGCCGTGGAAACTGTCCTCCGAGGCGGCACGTTGCGTCCGGTGCCGGAGC
TTCTCAACAGCTGCGGCGGATCGCCAACACTAACTTCCGACGATGTATCG
GAAGCTGAAGTGACTTGCACGGACATGTCTAGGTTGCAAGATCGGTCGTT
TCCAAGTTCTCATTGTAGATTCTCGAGTTCAAGATCCAAGGTGTCACCAG
CTAAACGTAAGAGAGTGGAAGAATCAGCAATGAAATTGCAACAGTCAGAT
CTGGATCTTCGCTTGACGCCAAGGTTTACGGGCAAGGTTCCGCCGGAAGT
CAGGCGGCGACCTGGTACTCCGTCGATGAATTCGGAGGAATCAGGCACCA
CTACGTGCTTCGAAAGTGGGTTAACAGATCATCGATATCTCAATGGAGCT
GANGAGAGGAAATTACTCAACTTGTTCGTTTGAGCAAATATTATCCCTTA
TTAGTTNCTTCCACTTTTAACTCTGTGAATTTATGTTCACGAAGAAAGAG
TGTACTATNATCCTTAGTTTTTGGNTTACCTTTGAGAGGATTTNCCCCGN
AACTGATTCCGGCGAGTTTTTGTATAATTACCGGCAGAAGATTTTTTTTT
TGGTTTTTCAACCGGGAAGAAAGGAAGGGAATTTGGCGGGAAGAACTTTC
TTTTT
back to top