EY659558

Overview
NameEY659558
Unique NameEY659558
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length948
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659558 vs. ExPASy Swiss-Prot
Match: DEGP1_ARATH (Protease Do-like 1, chloroplastic OS=Arabidopsis thaliana GN=DEGP1 PE=1 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 8.294e-16
Identity = 40/45 (88.89%), Postives = 42/45 (93.33%), Query Frame = 2
Query:   29 KVSNGSDLYRILDQCKVGDEVIVEVLRGDHKEKIPVKLEPKPDDT 163
            KVSNGSDLYRILDQCKVGDEV VEVLRGDHKEKI V LEPKPD++
Sbjct:  395 KVSNGSDLYRILDQCKVGDEVTVEVLRGDHKEKISVTLEPKPDES 439          
The following BLAST results are available for this feature:
BLAST of EY659558 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
DEGP1_ARATH8.294e-1688.89Protease Do-like 1, chloroplastic OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-011-E03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659558 ID=EY659558|Name=EY659558|organism=Citrus sinensis|type=EST|length=948bp
GTGACATCATTATTTCTGTGAATGGAAAAAAGTCTCCAATGGCAGCGACT
TGTACAGAATTCTTGACCAATGTAAAGTTGGAGATGAGGTGATTGTTGAG
GTATTGCGCGGAGATCATAAGGAGAAGATTCCGGTAAAACTTGAACCAAA
ACCAGATGATACTTAATATGCCAAAAGGTTTGGTTTGTATATTTTAAGTG
TAGTATATATACGATAAAGATGCCATTGTAGTTGTGCATCAATTGTTTTA
CCAAAACTGGTCTTTTCTTGTACATATTTCAGCAATTGTACCAATACGTG
ATATCAAGATTCCACTAAATTGATAAGCTAAATTGTCATCTCAAAAAAAA
AAATAAAAATAAAAGAAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAT
ATAAAAAAAAAAAAAANAAAAAAAAAAAAAACAAAATNACAAAAATCAAT
AAAAAAAACTCNTNATTATTATTATCACCTACCTNNNAACCTTNTTGGGG
GGGCGCCTTTAGAGGGACCAATTTTAATCCCCCGGGTGGGAAAAAAATAA
NGTTTTTTTTGTGGCCCCCAATTATATTTCCGGGCGCGGGGNNTAAAAAC
NGGGGAATGGGAAACCCCCGGCGCCCACCAATTATATGCGTGGGAGCCAT
CCCCCTTTTCCCCTTTGGGGTATAAAAAAGAGGGCCGGGCGGATGGCTTT
TACATAATGGGGAAATATTGTGGGGGAAGGGCCCCCCCCCTTAGAGGGCC
CTATACCGGGGGGGTGGGGGGGTTCCCCCACCGGGACCCTTATTTTTGGA
ACGGCCCAGCGCCCGCTTTTGNNTTTTTCCCTTTTTTGCACGCAAAGGCG
GGGTTTTCCCGAGANAATAAAGGGGGCGCCCTTTGGGGGCCCTTTTTTCT
TCTCGCCCCCCCCCCCAAATAATTTGGGGGGTGTGGTCCCCGGCGCCC
back to top