EY659549

Overview
NameEY659549
Unique NameEY659549
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length921
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659549_ssr557 microsatellite EY659549_ssr557:557..566. BLAST: Citrus ESTs to Prunus persica proteins V1
EY659549_ssr666 microsatellite EY659549_ssr666:666..675. BLAST: Citrus ESTs to Prunus persica proteins V1
EY659549_ssr397 microsatellite EY659549_ssr397:397..408. BLAST: Citrus ESTs to Prunus persica proteins V1
EY659549_ssr409 microsatellite EY659549_ssr409:409..428. BLAST: Citrus ESTs to Prunus persica proteins V1
EY659549_ssr564 microsatellite EY659549_ssr564:564..575. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659549 vs. ExPASy Swiss-Prot
Match: 12KD_FRAAN (Auxin-repressed 12.5 kDa protein OS=Fragaria ananassa PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.268e-21
Identity = 55/110 (50.00%), Postives = 68/110 (61.82%), Query Frame = 1
Query:   49 MLEKLWDDVVAGPQPDRGLGRLRKITTTPLAVKEGGEADSSSGKFQRSLSMXXXXXXXXXXXXXXXXXXXRKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDW 378
            +L+KLWDD+VAGPQP+RGLG LRK+   PL +K+ GE+           S                    RKDNVWRSVFHPGSNL+++ +G +VFD P  PNSPTVYDW
Sbjct:    3 LLDKLWDDIVAGPQPERGLGMLRKVPQ-PLNLKDEGES-----------SKITMPTTPTTPVTPTTPISARKDNVWRSVFHPGSNLSSKTMGNQVFDSP-QPNSPTVYDW 99          
The following BLAST results are available for this feature:
BLAST of EY659549 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
12KD_FRAAN1.268e-2150.00Auxin-repressed 12.5 kDa protein OS=Fragaria anana... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-011-D05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659549 ID=EY659549|Name=EY659549|organism=Citrus sinensis|type=EST|length=921bp
AGAAGAGCTATAGATTTAGAAACTAGCAGCTAACTCGTAAATTTAAAGAT
GCTAGAGAAGCTTTGGGACGATGTTGTGGCAGGGCCTCAGCCTGATCGTG
GCCTTGGCAGGCTGAGGAAAATCACCACAACACCCTTAGCAGTCAAAGAG
GGTGGTGAGGCGGATTCGTCGTCGGGCAAGTTCCAGAGGTCTCTGTCAAT
GCCAGCGAGTCCAGGGGCACCGTCGACGCCAGTGACGCCGACGACGCCGC
TGTCGGCGCGTAAGGACAACGTGTGGAGGAGCGTGTTTCACCCCGGTAGC
AACCTTGCTACTAGGGGTATCGGTGCAGAGGTCTTTGACAAGCCCACACA
TCCTAACTCTCCCACTGTTTATGACTGGTAAGTACGTGCGTGTGTCCTCA
CTCACTCACTCGCTCGCTCGCTCGCTCGCTCTTCACTTGCATAGATGCTG
CATGCTTGTTCTAACTTATTATTCTTTCTTTAGACCCTTATCAGTTGAAC
GCAAAGGCAACTTGTACTCTATCTATATATGTTTAATCATGTTCGGTTGC
TGATAAATATATATATTTATTTATTAATTTGGTCTCTTTTTCTCCCCCCC
TTTTTTAAAACTGAATTAATTCCCCGATCAGAAAAAAAACCGCAGCTTAT
TATATTCATGTGTGCGTGTGTGTGTTTTTTAAAAAGAAAATGATTGAACC
AAATCGATGGAGCATAAACTCAAACATCTCTGTTTTTGTTTTGTTTTTTT
TGCGGTCTTACTGGCTCTCTCAGCAACCAATAAAGGCTAAAGAATGAGGA
AACCTGGACTTTGTTTATGGGCGCGTGAATAGAACTTGGCTTATCAGAAT
GATCCTCATTCCACTTTTTGGAATCCTGCATTCTTCCTATTAAAGCAATG
AGGATAATAATATTTTGGGTT
back to top