EY659548

Overview
NameEY659548
Unique NameEY659548
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length923
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659548 vs. ExPASy Swiss-Prot
Match: WNK4_ARATH (Probable serine/threonine-protein kinase WNK4 OS=Arabidopsis thaliana GN=WNK4 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.385e-28
Identity = 91/244 (37.30%), Postives = 126/244 (51.64%), Query Frame = 1
Query:    1 IYFPYDIFNDTAPEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYXXXXXXXXXYGIYHPFYXXXXXXXXXXXLPAFFTN-NANSPPSWLQQEDLLGNDDASSNGSVNSFKYSSWDYHSGNEDDYEFSHRAGEPLCIARATQKSTRFCPEAAMNNDRCNSEDVNSWKACSTN----SNNHRILSRIRSLVDVRSQLLHRSLVEEIHMRRLFKTVGAIENIGVHEP 717
            ++FP+DI NDT+ +VA EMVKELEI DWEP+EIA+MI+  ISSLV +WK     +  H H                 H                A  +N  A     W+ Q+DL  +D+  S  S +S  YS+ +Y + +E      + +  P  +   T   TRFCPE    +    S   N++ A S+     ++++R L+R RSLVDV+ QLLHRS  EE   RRLFKTVG +E +G   P
Sbjct:  345 VFFPFDIMNDTSIDVAKEMVKELEIIDWEPVEIAKMIDGAISSLVSDWKYEEDDETPHDHH---------------RHRTDSFHSSSSHASSSQASLSNYMARGLQDWV-QDDL--HDETYSQSSSHSGSYSNLNYIAVDE------YSSQSP--VMSRTHNMTRFCPE---ESSHLQSGQANAYAASSSTNRSLASDNRTLTRNRSLVDVQRQLLHRSPGEEARKRRLFKTVGDVETVGFQSP 559          
BLAST of EY659548 vs. ExPASy Swiss-Prot
Match: WNK8_ORYSJ (Probable serine/threonine-protein kinase WNK8 OS=Oryza sativa subsp. japonica GN=WNK8 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 4.974e-26
Identity = 91/253 (35.97%), Postives = 117/253 (46.25%), Query Frame = 1
Query:    1 IYFPYDIFNDTAPEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYXXXXXXXXXYGIYHPFYXXXXXXXXXXXLPAFFTNNANSPPSWLQQEDLLGNDDASSNGSVNSFKYSSW--DY--------HSGNEDDYEFSHRAGEPLCIARATQ----KSTRFCPEAAMNNDRCNSEDVNSWKACSTNSNNHRILSRIRSLVDVRSQLLHRSLVEEIHMRRLFKTVGAIENIGVHEP 717
            IYFP+D+ NDTA EVA EMVKEL+I D EP EIA MIEQEI  LVP +K         QH +SY          G  +PFY                   ++SP S   Q  L G    SS G         W  DY           ++DD   S  +     I+   Q     S+R  P +A  ++          +         R +SR RS+VD+RSQLLHR+LVEE++ R  F TVGA+ +IG  +P
Sbjct:  365 IYFPFDVANDTAMEVATEMVKELDIADREPTEIAAMIEQEIVRLVPGYK---------QHEYSYADDDDDDDVNGQPNPFYYL-----------------SSSPTS--SQGSLCGVGPTSSEGFPGPHGKVDWSRDYCYYPPSSVSVSDDDDSSTSSLSAAVSAISLQQQHCSASSSRLGPASASASEDGGGHAGRPRQREGEEERRRRRMSRNRSMVDMRSQLLHRTLVEELNKRLFFNTVGAVHDIGFRDP 589          
BLAST of EY659548 vs. ExPASy Swiss-Prot
Match: WNK7_ORYSJ (Probable serine/threonine-protein kinase WNK7 OS=Oryza sativa subsp. japonica GN=WNK7 PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 4.210e-25
Identity = 92/261 (35.25%), Postives = 120/261 (45.98%), Query Frame = 1
Query:    1 IYFPYDIFNDTAPEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYXXXXXXXXXYGIYHPFYXXXXXXXXXXXLPAFFTNNANSPPSWLQQEDLLGNDDASSNGSVNSFKYSSW--DY-------HSGNEDDYEFSHRAGEPLCIARATQK-------STRFCP-EAAMNNDRCNSEDVNSWKACSTNSNNHRILSRIRSLVDVRSQLLHRSLVEEIHMRRLFKTVGAIENIGVHEPANCAA 732
            IYFP+D+ NDTA EVA EMVKEL+I D EP EIA MIEQEI  LVP +K         QH +SY          G  +PFY                   ++SP S   Q  L G    SS G         W  DY        S ++DD   +      +  +   Q+       S+R  P  A+ + D          +         R +SR RS+VD+RSQLLHR+LVEE++ R  F TVGA+ +IG  +P   A+
Sbjct:  366 IYFPFDVANDTAMEVATEMVKELDIADREPTEIAAMIEQEIVRLVPGYK---------QHEYSYADDNDDDDVSGHPNPFYYL-----------------SSSPTS--SQGSLCGVGSTSSEGFPGPHGKVDWSRDYCYYPPSSVSVSDDDDSSTSSLSAAVSASSLHQQQQHCSASSSRLGPASASASEDGGGGHAGRPRQREGEEERRRRRMSRNRSMVDMRSQLLHRTLVEELNKRLFFNTVGAVHDIGFRDPTAAAS 598          
BLAST of EY659548 vs. ExPASy Swiss-Prot
Match: WNK5_ARATH (Probable serine/threonine-protein kinase WNK5 OS=Arabidopsis thaliana GN=WNK5 PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 2.095e-16
Identity = 72/223 (32.29%), Postives = 98/223 (43.95%), Query Frame = 1
Query:    1 IYFPYDIFNDTAPEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYXXXXXXXXXYGIYHPFYXXXXXXXXXXXLPAFFTNNANSPPSWLQQEDLLGNDDASSNGSVNSFKYSSWDYHSGNEDDYEFSHRAGEPLCIARATQKSTRFCPEAAMNNDRCNSEDVNSWKACSTNSNNHRILSRIRSLVDVRSQLLHRSLVEEIHMRR 669
            I FP++I +DT  EVALEMVKELEITDW+PLEIA MIE EIS LVPNW+   +       SF +          G                     F++ ++S  S +   +   N+D SSN  +        D   GN                    + S R    +  +      +D N            R+  ++RSLVD R+Q+LHRSL+E I+ RR
Sbjct:  357 IQFPFNILSDTPLEVALEMVKELEITDWDPLEIAAMIENEISLLVPNWR--ANDSSIRHESFGHEDDEDNGDTEG-----------------RTRLFSSASSSHDSPVAVRE---NNDDSSNDVIP-------DMDDGN--------------------RSSNRLLNSSTYHYSPAIDDDQN-----QQQRRRVRLQQKMRSLVDTRTQVLHRSLMELINKRR 525          
The following BLAST results are available for this feature:
BLAST of EY659548 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
WNK4_ARATH2.385e-2837.30Probable serine/threonine-protein kinase WNK4 OS=A... [more]
WNK8_ORYSJ4.974e-2635.97Probable serine/threonine-protein kinase WNK8 OS=O... [more]
WNK7_ORYSJ4.210e-2535.25Probable serine/threonine-protein kinase WNK7 OS=O... [more]
WNK5_ARATH2.095e-1632.29Probable serine/threonine-protein kinase WNK5 OS=A... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-011-D04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659548 ID=EY659548|Name=EY659548|organism=Citrus sinensis|type=EST|length=923bp
ATATACTTTCCCTATGACATTTTCAATGATACTGCACCTGAAGTTGCCTT
GGAGATGGTGAAAGAATTGGAGATTACTGATTGGGAACCACTTGAAATCG
CTGAAATGATAGAGCAAGAAATATCTTCTTTGGTCCCGAATTGGAAGGAA
TGTGGCTCTCCCCAATTCTGTCATCAACACAGCTTTAGCTATGAAGATGA
AGATGATGACAATGACGACTACGGAATCTACCACCCTTTCTACTCTAACT
CTTCCCATTCCTCGTCGCACGCTTCTCTCCCAGCTTTCTTCACAAACAAT
GCGAATTCTCCTCCCAGTTGGCTTCAACAAGAAGACTTGTTGGGCAATGA
TGATGCGAGTTCCAATGGTTCTGTTAATTCTTTCAAGTACTCAAGCTGGG
ATTACCACTCAGGCAATGAAGATGATTATGAGTTCAGCCACAGAGCAGGA
GAGCCACTCTGCATTGCAAGGGCAACTCAAAAATCTACAAGATTCTGCCC
TGAAGCTGCCATGAACAATGACCGCTGCAATAGTGAAGATGTAAATTCCT
GGAAAGCTTGTAGTACAAACAGTAATAACCACAGGATATTGTCCAGGATT
CGGTCACTGGTTGATGTACGGAGCCAGTTGCTGCACAGGTCACTGGTGGA
GGAAATCCACATGAGGCGATTGTTTAAGACTGTTGGTGCTATTGAGAACA
TTGGGGTTCATGAACCAGCTAATTGTGCCGCTTACGGAAGATGCCCCGTT
NCAGATCATGACGAAAATTTGGAGCAGATTCCACATGATGATATTGGAAA
AAATGTTTTTGCTTNCGGGGGGTGTTATGGATGCTTTTTGTGGGAAAATA
AAAACTATTGACCTTGGAGCTGGAAATCTCGGCTGTGCCATATTGAACGA
CCCGTTCCAGTGATTAATAAATA
back to top