EY659545

Overview
NameEY659545
Unique NameEY659545
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length929
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: FAD6C_SOYBN (Omega-6 fatty acid desaturase, chloroplastic OS=Glycine max PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 2.372e-84
Identity = 156/262 (59.54%), Postives = 184/262 (70.23%), Query Frame = 3
Query:  111 MACRLADSMFLFMGPHQRPTGSQKIGCFSSPGLCQLKWESLLVKGVKHKRCSIPSRGTRFIQAVAVPVAPPSEDSADCRKQIAESYGFRQIGEPLPENVTMKDVIDSLPKKVFEIDDVKAWKSVLLSVSSYALGLLMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHHAKKTCLTEIQLGILFGKKSLTHLPFCAKQYILIW-PLSTLESIAHWLIWPFDLTKSR 893
            MAC LADS+ LF G +Q+P   + I    SPG+  L    L+ K  + +R  +       I AVA+PV P   +SA+ RKQ+AE YGFRQ+GEPL ++VT+KDVI+ LPK+VFEIDDVKAWKSVL+SV+SYALGL MISKAPWYLLPLAW WTGTA+TGFFVIGHDCAH+SFS NKL+ DIVGTLAF+PLIYPYEPWRFKHD+HHAK   L E        K      P   K  I  + P     SIAHWL+W FDL K R
Sbjct:    1 MACTLADSLLLFKGSYQKPVLRRDIAARYSPGIFSLNSNGLIQKRFRRQRNFVTRNKVTVIHAVAIPVQPAPVESAEYRKQLAEDYGFRQVGEPLSDDVTLKDVINPLPKEVFEIDDVKAWKSVLISVTSYALGLFMISKAPWYLLPLAWVWTGTAITGFFVIGHDCAHRSFSSNKLVEDIVGTLAFMPLIYPYEPWRFKHDRHHAKTNMLREDTAWHPVWKDEFESTPLLRKAIIYGYGPFRCWMSIAHWLMWHFDLKKFR 262          
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: FAD6C_ARATH (Omega-6 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD6 PE=1 SV=2)

HSP 1 Score: 307.375 bits (786), Expect = 7.629e-83
Identity = 162/268 (60.45%), Postives = 192/268 (71.64%), Query Frame = 3
Query:  111 MACRLADSMFLFMGPHQRPTGSQKIGCFS---SPGLCQLKWESLLVKGVKHK--RCSIP-SRGTRFIQAVAVPVAPPSEDSADCRKQIAESYGFRQIGEPLPENVTMKDVIDSLPKKVFEIDDVKAWKSVLLSVSSYALGLLMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHHAKKTCLTEIQLGILFGKKSLTHLPFCAKQYILIW-PLSTLESIAHWLIWPFDLTKSR 893
            MA R+ADS+F F GP Q      K+   S   SPG+  +K   LL+KG  H+  RC  P  R    I+AVA PVAPPS DSA+ R+Q+AESYGFRQIGE LPENVT+KD++D+LPK+VFEIDD+KA KSVL+SV+SY LGL MI+K+PWYLLPLAWAWTGTA+TGFFVIGHDCAHKSFSKNKL+ DIVGTLAFLPL+YPYEPWRFKHD+HHAK   L           +     P   K  I  + P+    SIAHW+ W F+L K R
Sbjct:    1 MASRIADSLFAFTGPQQCLPRVPKLAASSARVSPGVYAVKPIDLLLKGRTHRSRRCVAPVKRRIGCIKAVAAPVAPPSADSAEDREQLAESYGFRQIGEDLPENVTLKDIMDTLPKEVFEIDDLKALKSVLISVTSYTLGLFMIAKSPWYLLPLAWAWTGTAITGFFVIGHDCAHKSFSKNKLVEDIVGTLAFLPLVYPYEPWRFKHDRHHAKTNMLVHDTAWQPVPPEEFESSPVMRKAIIFGYGPIRPWLSIAHWVNWHFNLKKFR 268          
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: FAD6C_BRANA (Omega-6 fatty acid desaturase, chloroplastic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.700e-82
Identity = 156/263 (59.32%), Postives = 189/263 (71.86%), Query Frame = 3
Query:  111 MACRLADSMFLFMGPHQ-RPTGSQKIGCFSSPGLCQLKWESLLVKGVKHKRCSIPSRGTRFIQAVAVPVAPPSEDSADCRKQIAESYGFRQIGEPLPENVTMKDVIDSLPKKVFEIDDVKAWKSVLLSVSSYALGLLMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHHAKKTCLTEIQLGILFGKKSLTHLPFCAKQYILIW-PLSTLESIAHWLIWPFDLTKSR 893
            MA R+ADS+F F GP Q  P   +      SPG+  ++   LL+KG +        +    I+AV VPVAPPS D+A+ R+Q+AESYGF+QIG+ LP+NVT+KD++D+LPK+VFEIDDVKAWKSVL+SV+SYALGL MI+KAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKL+ DIVGTLAFLPL+YPYEPWRFKHD+HHAK   L           +     P   K  I  + P+    SIAHW+ W F+L K R
Sbjct:    1 MASRIADSLFAFTGPQQCLPRAPKLASARLSPGVYAVRPIDLLLKGTRRTFLVPAKKRIGCIKAVFVPVAPPSADNAEDREQLAESYGFKQIGQDLPDNVTLKDIMDTLPKEVFEIDDVKAWKSVLISVTSYALGLFMIAKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLVEDIVGTLAFLPLVYPYEPWRFKHDRHHAKTNMLVHDTAWQPVPPEEFDSSPVLRKAIIFGYGPIRPWLSIAHWVNWHFNLRKFR 263          
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: FAD6C_SPIOL (Omega-6 fatty acid desaturase, chloroplastic OS=Spinacia oleracea GN=FAD6 PE=1 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 9.987e-75
Identity = 142/242 (58.68%), Postives = 176/242 (72.73%), Query Frame = 3
Query:  195 SSPGLCQLKWESLLVKGVKHKRCSIPSRGTR----FIQAVAVPVAPPSE----DSADCRKQIAESYGFRQIGEPLPENVTMKDVIDSLPKKVFEIDDVKAWKSVLLSVSSYALGLLMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHHAKKTCLTEIQLGILFGKKSLTHLPFCAKQYILIW-PLSTLESIAHWLIWPFDLTKSR 893
            +S G+  +KW+   ++ + H R +   +GTR     +QAVAVPVA PS     D+ +  KQ+AE YGF+QIGEPLP++VTM+D+I SLPK+VFEI+D KAW +VL+SV+SYALG+ MI+KAPWYLLPLAWAWTGTA+TGFFVIGHDCAHKSFSKNKL+ DIVGTLAF+PLIYPYEPWRFKHD+HH K   L E    +   K+ +   P   K  I  + PL T  SIAHWL   F+L   R
Sbjct:   27 NSAGISCIKWQRPCLRNLGHVRLNQQRKGTRRKSTLVQAVAVPVAQPSAFPPTDNTEHLKQLAERYGFQQIGEPLPDDVTMRDIITSLPKQVFEINDTKAWGTVLISVTSYALGIFMIAKAPWYLLPLAWAWTGTAITGFFVIGHDCAHKSFSKNKLVEDIVGTLAFMPLIYPYEPWRFKHDQHHTKTNMLREDTAWLPIMKEDIESSPGLRKALIYAYGPLRTWMSIAHWLKVHFNLKDFR 268          
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: DESA_SYNY3 (Fatty acid desaturase OS=Synechocystis sp. (strain PCC 6803) GN=desA PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 5.189e-31
Identity = 56/108 (51.85%), Postives = 78/108 (72.22%), Query Frame = 3
Query:  402 NVTMKDVIDSLPKKVFEIDDVKAWKSVLLSVSSYALGLLMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHH 725
            ++ ++D+I +LPK+ FE    KAW SVL+++ + A+G L I   PWY LP+ W WTGTA+TG FV+GHDC H+SF+K + + D+VG +AF PLIYP+  WR  HD HH
Sbjct:   23 DLKLQDIIKTLPKECFEKKASKAWASVLITLGAIAVGYLGIIYLPWYCLPITWIWTGTALTGAFVVGHDCGHRSFAKKRWVNDLVGHIAFAPLIYPFHSWRLLHDHHH 130          
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: DESA_SPIPL (Fatty acid desaturase OS=Spirulina platensis GN=desA PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 3.194e-30
Identity = 56/104 (53.85%), Postives = 77/104 (74.04%), Query Frame = 3
Query:  414 KDVIDSLPKKVFEIDDVKAWKSVLLSVSSYALGLLMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHH 725
            +D+I++LP  VF  D  KAW +V+++V    LG L I+ APW+LLP+ W +TGTA+TGFFVIGHDC H+SFS+N  + D VG + FLP+IYP+  WR  H++HH
Sbjct:   26 EDIINTLPSGVFVQDRYKAWMTVIINVVMVGLGWLGIAIAPWFLLPVVWVFTGTALTGFFVIGHDCGHRSFSRNVWVNDWVGHILFLPIIYPFHSWRIGHNQHH 129          

HSP 2 Score: 23.0978 bits (48), Expect = 3.194e-30
Identity = 9/28 (32.14%), Postives = 14/28 (50.00%), Query Frame = 2
Query:  734 NMLDGDTAWHPVWKEEFDTSPLLRKAIY 817
            N ++ D AW P  KEE+  +    +  Y
Sbjct:  133 NRMELDNAWQPWRKEEYQNAGKFMQVTY 160          
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: FAD3C_SOYBN (Omega-3 fatty acid desaturase, chloroplastic OS=Glycine max GN=FAD7 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.422e-12
Identity = 40/115 (34.78%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  384 GEPLPENVTMKDVIDSLPKKVFEIDDVKAWKSVLLSVSS-YALGLLMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHH 725
            G P P N+   D+  ++PK  +  D  ++   V+  V + + L         W + PL WA  GT     FV+GHDC H SFS N  L  +VG L    ++ PY  WR  H  HH
Sbjct:   99 GAPPPFNLA--DIRAAIPKHCWVKDPWRSMSYVVRDVIAVFGLAAAAAYLNNWLVWPLYWAAQGTMFWALFVLGHDCGHGSFSNNSKLNSVVGHLLHSSILVPYHGWRISHRTHH 211          
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: FAD3E_TOBAC (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Nicotiana tabacum GN=FAD3 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.395e-12
Identity = 36/111 (32.43%), Postives = 56/111 (50.45%), Query Frame = 3
Query:  396 PENVTMKDVIDSLPKKVFEIDDVKAWKSVLLSVSSYALGL-LMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHH 725
            P    + ++ + +PK  +  D +++   V+  V   A  + + I    W   PL WA  GT     FV+GHDC H SFS ++LL ++VG +    ++ PY  WR  H  HH
Sbjct:   27 PPPFRLAEIRNVIPKHCWVKDPLRSLSYVVRDVIFVATLIGIAIHLDSWLFYPLYWAIQGTMFWAIFVLGHDCGHGSFSDSQLLNNVVGHILHSAILVPYHGWRISHKTHH 137          
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: FAD3E_ARATH (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Arabidopsis thaliana GN=FAD3 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.395e-12
Identity = 42/129 (32.56%), Postives = 58/129 (44.96%), Query Frame = 3
Query:  384 GEPLPENVTMKDVIDSLPKKVFEIDDVKA------WKSVLLSVSSY---------ALGLLMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHH 725
            G+P   +   ++  D   +  F+I D++A      W    L   SY         AL +  +    W+L PL WA  GT     FV+GHDC H SFS   LL  +VG +    ++ PY  WR  H  HH
Sbjct:   13 GDPGAGDRKKEERFDPSAQPPFKIGDIRAAIPKHCWVKSPLRSMSYVVRDIIAVAALAIAAVYVDSWFLWPLYWAAQGTLFWAIFVLGHDCGHGSFSDIPLLNSVVGHILHSFILVPYHGWRISHRTHH 141          
BLAST of EY659545 vs. ExPASy Swiss-Prot
Match: FAD3C_RICCO (Omega-3 fatty acid desaturase, chloroplastic OS=Ricinus communis GN=FAD7A-1 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.395e-12
Identity = 50/161 (31.06%), Postives = 71/161 (44.10%), Query Frame = 3
Query:  273 SRGTRFIQAVAVPVAPPSEDSADCRKQ--------IAESYG-FRQIGEPLPENVTMKDVIDSLPKKVFEIDDVKAWKSVLLSVSS-YALGLLMISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLGDIVGTLAFLPLIYPYEPWRFKHDKHH 725
            S+ + +   VAVPV   +    D R++        + E  G F   G P P   T+ D+  ++PK  +  +  ++   VL  V   + L  +      W   PL W   GT     FV+GHDC H SFS N  L  +VG L    ++ PY  WR  H  HH
Sbjct:   59 SKQSNWALNVAVPVNVSTVSGEDDREREEFNGIVNVDEGKGEFFDAGAPPP--FTLADIRAAIPKHCWVKNPWRSMSYVLRDVVVVFGLAAVAAYFNNWVAWPLYWFCQGTMFWALFVLGHDCGHGSFSNNPKLNSVVGHLLHSSILVPYHGWRISHRTHH 217          
The following BLAST results are available for this feature:
BLAST of EY659545 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
FAD6C_SOYBN2.372e-8459.54Omega-6 fatty acid desaturase, chloroplastic OS=Gl... [more]
FAD6C_ARATH7.629e-8360.45Omega-6 fatty acid desaturase, chloroplastic OS=Ar... [more]
FAD6C_BRANA1.700e-8259.32Omega-6 fatty acid desaturase, chloroplastic OS=Br... [more]
FAD6C_SPIOL9.987e-7558.68Omega-6 fatty acid desaturase, chloroplastic OS=Sp... [more]
DESA_SYNY35.189e-3151.85Fatty acid desaturase OS=Synechocystis sp. (strain... [more]
DESA_SPIPL3.194e-3053.85Fatty acid desaturase OS=Spirulina platensis GN=de... [more]
FAD3C_SOYBN2.422e-1234.78Omega-3 fatty acid desaturase, chloroplastic OS=Gl... [more]
FAD3E_TOBAC5.395e-1232.43Omega-3 fatty acid desaturase, endoplasmic reticul... [more]
FAD3E_ARATH5.395e-1232.56Omega-3 fatty acid desaturase, endoplasmic reticul... [more]
FAD3C_RICCO5.395e-1231.06Omega-3 fatty acid desaturase, chloroplastic OS=Ri... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-011-C12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659545 ID=EY659545|Name=EY659545|organism=Citrus sinensis|type=EST|length=929bp
AGAAATTCTATCCATCCACTTTTTTCACATTCACTCAATCCCAATTATAT
CCAAGTGGGAAGGGGGCTCTTGTGAATTGGAATTTCTGCATTTCTCTTGC
TCAAAACATAATGGCTTGCAGACTTGCAGATTCTATGTTCCTTTTCATGG
GCCCCCATCAAAGGCCAACTGGGAGTCAGAAAATTGGATGCTTTAGTTCA
CCTGGCCTTTGTCAGCTGAAGTGGGAGAGTCTTCTTGTGAAGGGAGTTAA
GCACAAAAGATGTTCAATTCCCTCTCGAGGGACTAGATTTATACAGGCTG
TGGCCGTTCCAGTTGCACCACCTTCAGAAGACAGTGCGGATTGTAGAAAG
CAGATAGCAGAAAGTTATGGGTTTAGGCAAATCGGAGAGCCACTGCCTGA
AAATGTGACAATGAAGGATGTCATTGATTCTCTCCCAAAAAAGGTATTTG
AGATTGATGATGTGAAAGCATGGAAGTCTGTTTTATTATCCGTCAGTTCA
TATGCGTTGGGGCTTCTCATGATCTCAAAGGCCCCATGGTATTTGCTTCC
TTTGGCTTGGGCATGGACAGGGACTGCGGTCACAGGGTTCTTTGTTATAG
GCCATGATTGTGCCCACAAATCATTTTCGAAGAACAAGTTACTGGGAGAC
ATCGTGGGAACCCTGGCCTTTCTGCCACTGATATACCCATATGAACCCTG
GCGGTTTAAGCACGACAAGCATCATGCCAAAAAAACATGCTTGACGGAGA
TACAGCTTGGCATCCTGTTTGGAAAGAAGAGTTTGACACATCTCCCCTTT
TGCGCAAAGCAATATATATTGATATGGCCCCTTTCGACCCTGGAGTCAAT
AGCTCACTGGTTGATCTGGCCCTTTGATTTGACCAAGTCACGCCACATGA
GTTAAAAGGGTGAAATAATTTGGCATGTG
back to top