EY659543

Overview
NameEY659543
Unique NameEY659543
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7489 contig Csv1_Contig7489:1..899. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: IMPL2_ARATH (Phosphatase IMPL2, chloroplastic OS=Arabidopsis thaliana GN=IMPL2 PE=1 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 3.384e-88
Identity = 166/260 (63.85%), Postives = 203/260 (78.08%), Query Frame = 2
Query:  110 QSSKPLLFSPVSLHNQTLTLHQNDAQALPFSPAINYHSVSLKTTTVSAMTSNS---NLSNHAVTSNGISEPDLDRFADVGNKLADAAGEVIRKYFRKKFEIIDKEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEENGWRCKEKFADYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAKLSQAYLYTTSPHLFKGDAEEAFARVRNXVKVPLLCCDCYAYA 880
            +S+ P L    S  N  L+   + A A+P S          +      M SNS   N+SN + +   +S+ +LDRFA VGN LADA+GEVIRKYFRKKF+I+DK+D+SPVTIAD+ AEEAMV II +NLPSHAI+GEE GWRCKE+ ADYVWVLDPIDGTKSFITGKP+FGTLIALL+KGKPILG+IDQP+L+ERWIG++G+ T LNGE++STR+C KLSQAYLYTTSPHLF  +AE+A++RVR+ VKVPL  CDCYAYA
Sbjct:   23 RSANPSLRISSSYSNSRLSFLSSSAIAVPVS----------RRRFCLTMASNSKRPNISNESPSE--LSDTELDRFAAVGNALADASGEVIRKYFRKKFDIVDKDDMSPVTIADQMAEEAMVSIIFQNLPSHAIYGEEKGWRCKEESADYVWVLDPIDGTKSFITGKPVFGTLIALLYKGKPILGLIDQPILKERWIGMNGRRTKLNGEDISTRSCPKLSQAYLYTTSPHLFSEEAEKAYSRVRDKVKVPLYGCDCYAYA 270          
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: Y733_CHLP8 (Uncharacterized protein Cpar_0733 OS=Chlorobaculum parvum (strain NCIB 8327) GN=Cpar_0733 PE=3 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 3.692e-18
Identity = 63/187 (33.69%), Postives = 92/187 (49.20%), Query Frame = 2
Query:  344 KLADAAGEVIRKYF-RKKFEIIDKEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEE-------NGWRCKEKFADYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAKLS-QAYLYTTSPHLFKGDAEEAFARVRNXVKVPLLCCDCYAY 877
            +LA+ AG++   YF R+  ++  K D +PVT ADR AEE +   I    P   +FGEE       NG R         W++DPIDGT+SFI G PL+G +IAL  +G   LG+I+ P L E +    G    +NG  V     A+ S    ++T   +L    +     ++R    +     DCY +
Sbjct:   10 ELAEKAGKLTLDYFGRRSLQVFSKRDDTPVTEADRNAEELIRQGISAKFPDDGLFGEEFDEHPSGNGRR---------WIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPALGELYQAERGSGAFMNGSPVQVSAIAENSASTVVFTEKEYLLDPPSNHPVDQLRIDAGLVRGWGDCYGH 187          
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: IMP3_SOLLC (Inositol monophosphatase 3 OS=Solanum lycopersicum GN=IMP3 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.225e-18
Identity = 51/156 (32.69%), Postives = 84/156 (53.85%), Query Frame = 2
Query:  317 LDRFADVGNKLADAAGEVIRKYFRKKFEIIDKEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEENGWRCK--EKFADYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAKLSQAYLYT 778
            +++F DV  + A  AGE+IR+ F K   +  K  +  VT  D+  E+ +   +++  PSH   GEE    C   E   +  W++DP+DGT +F+ G P     I L  + KP +G++  P++ E + GI GK   LNG+ +   + ++L +A L T
Sbjct:    7 VEQFLDVAVEAAKKAGEIIREGFYKTKHVEHKGMVDLVTETDKACEDFIFNHLKQRFPSHKFIGEETTAACGNFELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIEKKPTVGVVYNPIIDELFTGIDGKGAFLNGKPIKVSSQSELVKALLAT 162          
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: SUHB_PSEAE (Inositol-1-monophosphatase OS=Pseudomonas aeruginosa GN=suhB PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.456e-16
Identity = 52/155 (33.55%), Postives = 82/155 (52.90%), Query Frame = 2
Query:  332 DVGNKLADAAGEVIRKYFRKK--FEIIDKEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEENGW-RCKEKFADYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAKLSQAYLYTTSP 787
            ++  + A +AGE+I +   +     + +K+    VT  DR AE+ +V  +++  P+HAI GEE G+     + ADY+WV+DP+DGT +FI G P F   IA  +KG+    ++  PV +E +    G+   LNG  +       L  A L T  P
Sbjct:    6 NIALRAARSAGELIFRSIERLDVISVNEKDAKDYVTEVDRAAEQTIVAALRKAYPTHAIMGEEGGFIEGSGEGADYLWVIDPLDGTTNFIHGVPHFAVSIACKYKGRLEHAVVLDPVRQEEFTASRGRGAALNGRRLRVSGRKSLEGALLGTGFP 160          
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: IMP2_SOLLC (Inositol monophosphatase 2 OS=Solanum lycopersicum GN=IMP2 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.715e-15
Identity = 48/157 (30.57%), Postives = 80/157 (50.96%), Query Frame = 2
Query:  317 LDRFADVGNKLADAAGEVIRKYFRKKFEIIDKEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEENGWRCKEKFA---DYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAKLSQAYLYT 778
            ++ F DV  + A  AGE+IR  F K   I  K  +  VT  D+  E  +   +++  PSH   GEE        F    +  W++DP+DGT +F+ G P     I L  + KP++G++  P++ E +  I G+   LNG+ +   + ++L +A + T
Sbjct:    1 MEEFVDVAIEAAKKAGEIIRHGFYKSKHIEHKGVVDLVTETDKACEVLIFNHLKQCFPSHKFIGEETTAAASGNFELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIEKKPVVGVVYNPIIDELFTAIYGRGAFLNGKSIRVSSESQLVKALVAT 157          
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: IMP1_SOLLC (Inositol monophosphatase 1 OS=Solanum lycopersicum GN=IMP1 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.715e-15
Identity = 47/156 (30.13%), Postives = 81/156 (51.92%), Query Frame = 2
Query:  317 LDRFADVGNKLADAAGEVIRKYFRKKFEIIDKEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEENGWRCKE--KFADYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAKLSQAYLYT 778
            L+ F  V    A  AGE+IRK F +   ++ K  +  VT  D+  E+ +   ++++ PSH   GEE      +     +  W++DP+DGT +F+ G P     I L     P +G++  P++ E + GI+GK   LNG+ +   + ++L ++ L T
Sbjct:    7 LEEFLGVAVDAAKRAGEIIRKGFHETKHVVHKGQVDLVTETDKACEDLIFNHLKQHFPSHKFIGEETSAATGDFDLTDEPTWIVDPVDGTTNFVHGFPSVCVSIGLTIGKIPTVGVVYDPIIDELFTGINGKGAYLNGKPIKVSSQSELVKSLLGT 162          
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: VTC4_ARATH (Inositol-phosphate phosphatase OS=Arabidopsis thaliana GN=VTC4 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.240e-15
Identity = 47/156 (30.13%), Postives = 78/156 (50.00%), Query Frame = 2
Query:  317 LDRFADVGNKLADAAGEVIRKYFRKKFEIIDKEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEEN--GWRCKEKFADYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAKLSQAYLYT 778
            LD+F       A  AG++IRK F +   +  K  +  VT  D+  EE +   +++  P+H   GEE    +   E   +  W++DP+DGT +F+ G P     I L     P++G++  P++ E + G+ GK   LNG+ +     ++L  A L T
Sbjct:    7 LDQFLAAAIDAAKKAGQIIRKGFYETKHVEHKGQVDLVTETDKGCEELVFNHLKQLFPNHKFIGEETTAAFGVTELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIGKVPVVGVVYNPIMEELFTGVQGKGAFLNGKRIKVSAQSELLTALLVT 162          
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: SUHB_AQUAE (Inositol-1-monophosphatase OS=Aquifex aeolicus GN=suhB PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.990e-15
Identity = 46/153 (30.07%), Postives = 82/153 (53.59%), Query Frame = 2
Query:  314 DLDRFADVGNKLADAAGEVIRKYFRK--KFEIIDKEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEENGWRCKEKFADYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAKLSQA 766
            +L ++ +V    A A G+V+++ F K  K  I +K +   V+  D+T+EE +  +I +  P H + GEE G   +   ++Y W +DP+DGTK++I G P+F   + L+   +PI+G +  P   + + G  G    +NG+ +  +    L  A
Sbjct:    3 NLKKYLEVAKIAALAGGQVLKENFGKVKKENIEEKGEKDFVSYVDKTSEERIKEVILKFFPDHEVVGEEMG--AEGSGSEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHA 153          
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: SUHB_PASMU (Inositol-1-monophosphatase OS=Pasteurella multocida GN=suhB PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.896e-14
Identity = 49/173 (28.32%), Postives = 87/173 (50.29%), Query Frame = 2
Query:  332 DVGNKLADAAGEVIRKYFRKKFEIID--KEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEENGWRCKEKFADYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAKLSQAYLYTTSPHLFKGDAEEAFARVRNXVK 844
            ++  + A  AG VI K + ++ ++    K     VT  D+ +EEA++ +I+++ P H I  EE+G   + K +D  WV+DP+DGT +F+ G P F   IA+  KG+  +G++  P+  E +  + G+   +N   +       L+   L T  P          FA + N ++
Sbjct:    6 NIAIRAARKAGNVIAKGYERRDDLQTTLKSTNDYVTNIDKASEEAIIEVIRKSYPDHTIITEESG-ALEGKDSDIQWVIDPLDGTTNFVKGLPHFSVSIAIRVKGRTEVGVVYDPIRNELFTAVRGEGAKINDMRLRVENKRDLAGTVLTTGFPFKQTRLMPMQFAMMNNLIQ 177          
BLAST of EY659543 vs. ExPASy Swiss-Prot
Match: SUHB_HAEIN (Inositol-1-monophosphatase OS=Haemophilus influenzae GN=suhB PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.576e-13
Identity = 45/143 (31.47%), Postives = 77/143 (53.85%), Query Frame = 2
Query:  332 DVGNKLADAAGEVIRKYFRKK--FEIIDKEDLSPVTIADRTAEEAMVLIIQENLPSHAIFGEENGWRCKEKFADYVWVLDPIDGTKSFITGKPLFGTLIALLHKGKPILGIIDQPVLRERWIGISGKCTTLNGEEVSTRTCAK 754
            ++  + A  AG VI K + ++   E   K     VT  D+ +E  ++ +I+++ P H I  EE G   + K +D  W++DP+DGT++F+TG P F   IA+  K +  +G++  P+  E +  + G+   LN  EV  R  +K
Sbjct:    6 NIAIRAARKAGNVIAKNYERRDAIESTQKGINDYVTNVDKASEAEIIEVIRKSYPDHTIITEETG-AIEGKDSDVQWIIDPLDGTRNFMTGLPHFSVSIAVRVKNRTEVGVVYDPIRNELFTAVRGEGAKLN--EVRLRVDSK 145          
The following BLAST results are available for this feature:
BLAST of EY659543 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
IMPL2_ARATH3.384e-8863.85Phosphatase IMPL2, chloroplastic OS=Arabidopsis th... [more]
Y733_CHLP83.692e-1833.69Uncharacterized protein Cpar_0733 OS=Chlorobaculum... [more]
IMP3_SOLLC8.225e-1832.69Inositol monophosphatase 3 OS=Solanum lycopersicum... [more]
SUHB_PSEAE3.456e-1633.55Inositol-1-monophosphatase OS=Pseudomonas aerugino... [more]
IMP2_SOLLC1.715e-1530.57Inositol monophosphatase 2 OS=Solanum lycopersicum... [more]
IMP1_SOLLC1.715e-1530.13Inositol monophosphatase 1 OS=Solanum lycopersicum... [more]
VTC4_ARATH2.240e-1530.13Inositol-phosphate phosphatase OS=Arabidopsis thal... [more]
SUHB_AQUAE4.990e-1530.07Inositol-1-monophosphatase OS=Aquifex aeolicus GN=... [more]
SUHB_PASMU1.896e-1428.32Inositol-1-monophosphatase OS=Pasteurella multocid... [more]
SUHB_HAEIN3.576e-1331.47Inositol-1-monophosphatase OS=Haemophilus influenz... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-011-C10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659543 ID=EY659543|Name=EY659543|organism=Citrus sinensis|type=EST|length=899bp
CTTATCTGGCATTCACTTCACTTTCTCTCAATCACAAGCATCAATTTTCC
CGCGTATTTAAAACCCTCAAATCACTTCGCAAATGCTTTCTCAATTCAAC
TTCCTCTCTCAATCTTCCAAACCTCTCCTGTTTTCTCCTGTTTCCTTGCA
CAACCAAACGCTAACTCTCCATCAAAACGACGCCCAGGCGCTGCCGTTTT
CTCCCGCCATAAATTACCACTCAGTTTCTCTCAAAACAACAACTGTATCT
GCAATGACTTCAAATTCGAATCTCTCCAATCACGCCGTCACTAGTAACGG
CATTAGCGAGCCCGACCTCGATCGCTTTGCCGACGTCGGCAACAAACTCG
CCGACGCCGCCGGAGAAGTTATCCGCAAATATTTTCGAAAGAAATTCGAA
ATTATCGATAAAGAGGATTTGAGTCCTGTGACAATTGCAGATCGAACAGC
AGAAGAAGCTATGGTTTTGATTATTCAAGAGAATTTACCTTCTCATGCTA
TTTTTGGTGAGGAGAATGGGTGGAGGTGTAAGGAGAAGTTTGCAGATTAT
GTTTGGGTTTTAGATCCAATAGATGGGACCAAGAGCTTTATCACTGGAAA
ACCTCTGTTTGGTACTCTCATTGCTTTGCTACATAAAGGCAAACCAATTC
TTGGCATAATTGATCAGCCTGTTCTAAGAGAAAGATGGATTGGAATCAGT
GGAAAGTGCACTACACTAAACGGAGAAGAAGTGTCCACTCGCACTTGTGC
CAAACTGTCACAAGCTTATTTATACACTACAAGCCCACACCTGTTCAAAG
GAGATGCTGAAGAAGCATTTGCTCGTGTAAGAAATAANGTGAAAGTGCCC
CTTTTATGTTGTGACTGCTATGCGTATGCCCCTTCTGCTTTCAGAATGT
back to top