EY659515

Overview
NameEY659515
Unique NameEY659515
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length940
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659515_ssr362 microsatellite EY659515_ssr362:362..371. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP_CUCSA (Oxygen-evolving enhancer protein 2, chloroplastic OS=Cucumis sativus GN=PSBP PE=2 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 4.831e-101
Identity = 189/251 (75.30%), Postives = 210/251 (83.67%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRHVSNIK-PTQIVCRAQKQA-VQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASVR----PPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            MAST CFLHHHAL T  AR+SSS R  +  K P  +VCRAQKQ   QE++G  VSRRLALTVLIGAAA+GSKVSPADAAYGE+ANVFGKPK+NTD+LPY+GDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSN+SVII PTDKKSI D+GSPEEFLSKVDYLLGKQAY GKT+S+GGFDPDAV TANIL+A+        YYF+SVL RTADGDEGG H LITATV  G+LYIC   AG + W + +R
Sbjct:    1 MASTSCFLHHHAL-TAAARSSSSPRQAALPKSPQLLVCRAQKQQPAQEEEGGVVSRRLALTVLIGAAALGSKVSPADAAYGEAANVFGKPKSNTDYLPYSGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNLSVIINPTDKKSIKDFGSPEEFLSKVDYLLGKQAYFGKTASEGGFDPDAVATANILEATASNVNGKDYYFVSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAR 250          
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP1_TOBAC (Oxygen-evolving enhancer protein 2-1, chloroplastic OS=Nicotiana tabacum GN=PSBP1 PE=3 SV=2)

HSP 1 Score: 361.303 bits (926), Expect = 4.522e-99
Identity = 184/255 (72.16%), Postives = 212/255 (83.14%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSS---QRHVSNIKPTQIVCRAQKQAV-QEDDGSAV--SRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASVR----PPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            MASTQCFLH HALS++ ART+SS   QR+VS++KP Q+VCRAQKQ+  QEDDG++V  SRRLALTVLIGAAA+GSKVSPADAAYGE+ANVFGKPK NTDFL YNGDGFKL +P+KWNPSKE EFPGQVLRYEDNFDS SN+ V +TPTDKKSITDYGSPEEFL++VD+LLGKQAY GKT S+GGF+  AV TAN+L+ S        YY LSVL RTADGDEGG H LI+ATV GG+LYIC   AG + W + +R
Sbjct:    1 MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSRRLALTVLIGAAAIGSKVSPADAAYGEAANVFGKPKENTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITDYGSPEEFLTQVDFLLGKQAYFGKTDSEGGFESGAVATANLLETSSSTVGGKEYYILSVLTRTADGDEGGKHQLISATVNGGKLYICKAQAGDKRWFKGAR 255          
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP1_ARATH (Oxygen-evolving enhancer protein 2-1, chloroplastic OS=Arabidopsis thaliana GN=PSBP1 PE=1 SV=2)

HSP 1 Score: 358.607 bits (919), Expect = 2.931e-98
Identity = 178/252 (70.63%), Postives = 213/252 (84.52%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSS---QRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASVR----PPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            MA + CFLH  AL+++ AR+SSS   QRHVS  KP QI+C+AQ+    EDD SAVSRRLALT+L+GAAAVGSKVSPADAAYGE+ANVFGKPKTNTDFLPYNGDGFK+ +P+KWNPSKE E+PGQVLR+EDNFD+ SN++V++TPTDKKSITDYGSPEEFLS+V+YLLGKQAY G+T+S+GGFD +AV TANIL++S +     PYY+LSVL RTADGDEGG H LITATV GG+LYIC   AG + W + +R
Sbjct:    1 MAYSACFLHQSALASSAARSSSSSSSQRHVSLSKPVQIICKAQQS--HEDDNSAVSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGAR 250          
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP_SOLTU (Oxygen-evolving enhancer protein 2, chloroplastic OS=Solanum tuberosum GN=PSBP PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 6.111e-96
Identity = 178/249 (71.49%), Postives = 202/249 (81.12%), Query Frame = 3
Query:   24 ASTQCFLH-HHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASVR----PPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            ASTQCFLH +HAL ++PARTSS    V + KP Q++CRAQKQ    +  +AVSRRLALT+LIG AA+GSKVSPADAAYGE+ANVFGKPK NTDFLPYNGDGFKL IP+KWNPSKE EFPGQVLRYEDNFDS SN+ V +TPTDKKSITDYGSPEEFLSKVDYLLGKQAY GKT S+GGF+  AV TAN+L+AS        YY+LSVL RTADGDEGG H LITATV  G+LYIC   AG + W + ++
Sbjct:    3 ASTQCFLHQYHALRSSPARTSS----VPSPKPNQLICRAQKQDDANNTSNAVSRRLALTLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQIPAKWNPSKEIEFPGQVLRYEDNFDSTSNLMVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEGGFESGAVATANLLEASSATVGGKQYYYLSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAK 247          
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP2_TOBAC (Oxygen-evolving enhancer protein 2-2, chloroplastic OS=Nicotiana tabacum GN=PSBP2 PE=1 SV=2)

HSP 1 Score: 346.665 bits (888), Expect = 1.152e-94
Identity = 177/253 (69.96%), Postives = 206/253 (81.42%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQI-VCRAQKQAVQEDDGS---AVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASVR----PPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            MASTQCFLHHHALST PART   +  V ++KP Q+ VCRAQKQ+  ++D     +VSRRLALTVLIGAAAVGSKVSPADAAYGE+ANVFGKPKT+TDF  YNGDGFKL IPSKWNP+KE E+PGQVLR+EDNFD+ SNV V ITPTDKKSITD+GSPE+FLS+VDYLLG+QAYSGKT S+GGF+ DAV  AN+L+ S       PYY+LSVL RTADG+EGG H LITATV  G+LYIC   AG + W + ++
Sbjct:    1 MASTQCFLHHHALST-PARTPLVRSIVPSLKPNQLLVCRAQKQSAPQEDNVNSVSVSRRLALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSSAEVGGKPYYYLSVLTRTADGNEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAK 252          
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP_SOLLC (Oxygen-evolving enhancer protein 2, chloroplastic OS=Solanum lycopersicum GN=PSBP PE=2 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 1.505e-94
Identity = 179/251 (71.31%), Postives = 203/251 (80.88%), Query Frame = 3
Query:   24 ASTQCFLH-HHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGS--AVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASVR----PPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            ASTQCFLH +HAL ++PARTSS    VS+ KP Q++CRAQKQ    DD S  AVSRRLALT+LIG AA+GSKVSPADAAYGE+ANVFGKPK NTDFLPYNGDGFKL +P+KWNPSKE E+PGQVLRYEDNFDS SN+ V +TPTDKKSITDYGSPEEFLSKVDYLLGKQAY GKT S+GGF+  AV T N+L+AS        YY+LSVL RTADGDEGG H LITATV  G+LYIC   AG + W + ++
Sbjct:    3 ASTQCFLHQYHALRSSPARTSS----VSSPKPNQLICRAQKQ----DDASNAAVSRRLALTLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQVPAKWNPSKEVEYPGQVLRYEDNFDSTSNLIVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEGGFESGAVATRNLLEASSATVGGKEYYYLSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAK 245          
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP_PEA (Oxygen-evolving enhancer protein 2, chloroplastic OS=Pisum sativum GN=PSBP PE=1 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 2.567e-94
Identity = 178/249 (71.49%), Postives = 199/249 (79.92%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASV----RPPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            MASTQCFLHH    TTP RT S QR V   KP  IVC+AQKQ    D  + VSRRLAL+VLIGAAAVGSKVSPADAAYGE+ANVFGK KTNTD+LPYNGDGFKL +P+KWNPSKEREFPGQVLRYEDNFD+ SNVSV++  TDKKSITDYGSPEEFLSKVDYLLGKQA+ G+T S+GGFD +AV  ANIL++S        YY +SVL RTADGDEGG H LITATVK G+LYIC   AG + W + +R
Sbjct:    1 MASTQCFLHHQYAITTPTRTLS-QRQVVTTKPNHIVCKAQKQDDVVD--AVVSRRLALSVLIGAAAVGSKVSPADAAYGEAANVFGKAKTNTDYLPYNGDGFKLLVPAKWNPSKEREFPGQVLRYEDNFDATSNVSVLVQTTDKKSITDYGSPEEFLSKVDYLLGKQAFFGQTDSEGGFDTNAVAVANILESSAPVIGGKQYYNISVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGAR 246          
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP_SPIOL (Oxygen-evolving enhancer protein 2, chloroplastic OS=Spinacia oleracea GN=PSBP PE=1 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 4.842e-93
Identity = 172/254 (67.72%), Postives = 206/254 (81.10%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPA--RTSSSQRHVS-NIKPTQIVCRAQKQAVQEDD--GSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASV----RPPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            MAST CFLHHHA  ++PA  R S++QR+ + +IKP QIVC+AQKQ   E +   S VSRRLALTVLIGAAAVGSKVSPADAAYGE+ANVFGKPK NT+F+PYNGDGFKL +PSKWNPSKE+EFPGQVLRYEDNFD+ SN+SV++ PTDKKSITD+GSPE+FLS+VDYLLGKQAY GKT S+GGFD   V +AN+L++S        YY ++VL RTADGDEGG H +I ATVK G+LYIC   AG + W + ++
Sbjct:    1 MASTACFLHHHAAISSPAAGRGSAAQRYQAVSIKPNQIVCKAQKQDDNEANVLNSGVSRRLALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFPGQVLRYEDNFDATSNLSVLVQPTDKKSITDFGSPEDFLSQVDYLLGKQAYFGKTDSEGGFDSGVVASANVLESSTPVVDGKQYYSITVLTRTADGDEGGKHQVIAATVKDGKLYICKAQAGDKRWFKGAK 254          
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP_FRIAG (Oxygen-evolving enhancer protein 2, chloroplastic OS=Fritillaria agrestis GN=PSBP PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 1.558e-91
Identity = 171/252 (67.86%), Postives = 201/252 (79.76%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRH--VSNIKPTQIVCRAQKQA-VQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASV----RPPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            MAS+ CFL HHA ST PA TS +  H  V  IKP+Q++CRAQK +   E+  +AVSRRLALT+LIG+AAVG+K++PA+AAYGE+ANVFGK KTNTDFLPY GDGF L IP+KWNPSKE EFPGQVLRYEDNFD  SNVSV +TPT KKSITDYG+PEEFLS VDYLLGKQAYSGKT+S+GGFDPD+V TANIL+ S        YY +SVL RTADGDEGG H +I+ATV  G+LYIC   AG + W + ++
Sbjct:    1 MASSACFLLHHAPST-PATTSRTPSHRLVPTIKPSQLICRAQKSSDTDENSSTAVSRRLALTILIGSAAVGTKIAPANAAYGEAANVFGKAKTNTDFLPYTGDGFNLLIPAKWNPSKEVEFPGQVLRYEDNFDVTSNVSVTVTPTSKKSITDYGTPEEFLSTVDYLLGKQAYSGKTASEGGFDPDSVATANILEVSTPVVGGKQYYNISVLTRTADGDEGGKHHVISATVTDGKLYICKAQAGDKRWFKGAK 251          
BLAST of EY659515 vs. ExPASy Swiss-Prot
Match: PSBP3_TOBAC (Oxygen-evolving enhancer protein 2-3, chloroplastic OS=Nicotiana tabacum GN=PSBP3 PE=2 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 2.657e-91
Identity = 173/254 (68.11%), Postives = 204/254 (80.31%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQI-VCRAQ-KQAVQEDDGS---AVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSDGGFDPDAVGTANILDASVR----PPYYFLSVLNRTADGDEGGXHXLITATVKGGQLYICXGTAGRQMWVRXSR 755
            MASTQCFLHHHALST PARTS  +  V ++K  Q+ VCRAQ KQ+  + D     +VSRRLALT+LIGAAAVGSKVSPADAAYGE+ANVFGKPKT+TDF  YNGDGFKL IPSKWNP+KE E+PGQVLR+EDNFD+ SNV V ITPTDKKSITD+GSPE+FLS+VDYLLG+QAYSGKT S+GGF+ DAV  AN+L+ S        YY+LS+L RTADG+EGG H L+TATV  G+LYIC   AG + W + ++
Sbjct:    1 MASTQCFLHHHALST-PARTSLVRGIVPSLKSNQLLVCRAQNKQSAPQQDNVNSVSVSRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSTAEVGGKQYYYLSILTRTADGNEGGKHQLVTATVNDGKLYICKAQAGDKRWFKGAK 253          
The following BLAST results are available for this feature:
BLAST of EY659515 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
PSBP_CUCSA4.831e-10175.30Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP1_TOBAC4.522e-9972.16Oxygen-evolving enhancer protein 2-1, chloroplasti... [more]
PSBP1_ARATH2.931e-9870.63Oxygen-evolving enhancer protein 2-1, chloroplasti... [more]
PSBP_SOLTU6.111e-9671.49Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP2_TOBAC1.152e-9469.96Oxygen-evolving enhancer protein 2-2, chloroplasti... [more]
PSBP_SOLLC1.505e-9471.31Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_PEA2.567e-9471.49Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_SPIOL4.842e-9367.72Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_FRIAG1.558e-9167.86Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP3_TOBAC2.657e-9168.11Oxygen-evolving enhancer protein 2-3, chloroplasti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-011-A03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659515 ID=EY659515|Name=EY659515|organism=Citrus sinensis|type=EST|length=940bp
CCACGCGTCCGAAAAGAAAAATGGCATCAACTCAATGCTTCTTGCACCAC
CATGCACTCTCTACTACACCAGCAAGAACATCATCATCTCAGCGCCACGT
GTCGAACATCAAGCCCACCCAGATTGTCTGCCGTGCGCAGAAGCAAGCTG
TCCAAGAAGATGACGGCAGCGCCGTCTCCCGCCGTTTGGCTCTGACGGTG
CTCATTGGTGCTGCTGCCGTCGGCTCCAAGGTCTCTCCTGCCGACGCTGC
CTACGGTGAATCAGCCAATGTGTTTGGTAAGCCAAAGACCAACACTGACT
TCTTGCCATACAATGGAGATGGATTCAAGCTGTCGATTCCCTCAAAATGG
AACCCCAGCAAAGAGAGAGAGTTCCCGGGTCAGGTTCTTAGATACGAAGA
CAACTTCGATTCCAACAGCAATGTCTCCGTCATAATCACCCCAACTGACA
AGAAATCCATCACTGACTACGGTTCCCCCGAGGAATTCCTCAGTAAGGTG
GACTACTTGCTGGGAAAACAAGCCTATTCCGGCAAAACTTCGTCTGATGG
TGGTTTCGACCCTGATGCTGTGGGCACAGCTAACATCTTGGATGCTTCAG
TCCGACCACCATACTACTTCTTGTCTGTATTAAACAGAACTGCTGATGGA
GATGAAGGTGGCANGCATNCACTAATTACAGCCACGGTTAAGGGTGGGCA
GCTTTACATCTGCANGGGCACAGCTGGGAGACAGATGTGGGTTAGGGNAA
GCAGATAGATGTGGGAAGCACTGCCAGGTCTTTAGTGGGTGCTGAGACAT
TATCAGAATTTTNATGTAATCCCACTAATGGATGCTGGTTGGTTTGAATA
TCTACTCCCATCTTTCCCAAAGCTTTGGAGTTCTATTGAAGAGTGGTTGG
AAAAAAAAAAAAAAAAAAAAAGGGGCGCCGTCTTAAGATC
back to top