EY659491

Overview
NameEY659491
Unique NameEY659491
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length976
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: CBP3_HORVU (Serine carboxypeptidase 3 OS=Hordeum vulgare GN=CBP3 PE=1 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 1.413e-92
Identity = 78/124 (62.90%), Postives = 94/124 (75.81%), Query Frame = 1
Query:  307 EHPQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPCIQYKEYTEYALNMRLXQTSDYESINKLIPTCEHAIXNCESDGGDACSSSYXCLHSIFNKXXGIAGDVN 678
            +HP++ KNDF+ITGESYAGHYIPAFASRVH+GNK  +G HINLKGFAIGNGLTDP IQYK YT+YAL M L Q +DYE INK IP CE AI  C ++G  +C ++Y   ++IFN    + G  N
Sbjct:  208 KHPEFIKNDFFITGESYAGHYIPAFASRVHQGNKKNEGTHINLKGFAIGNGLTDPAIQYKAYTDYALEMNLIQKADYERINKFIPPCEFAIKLCGTNGKASCMAAYMVCNTIFNSIMKLVGTKN 331          

HSP 2 Score: 153.68 bits (387), Expect = 1.413e-92
Identity = 69/85 (81.18%), Postives = 75/85 (88.24%), Query Frame = 2
Query:   53 KSHPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQ 307
            K  PVVIWLTGGPGCSSELA+FYENGPF IANN+SLVWN +GWD  SN++FVDQPTGTGFSY+SD  D RHDE GVSNDLYDFLQ
Sbjct:  119 KEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQ 203          

HSP 3 Score: 59.3066 bits (142), Expect = 1.413e-92
Identity = 33/73 (45.21%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  689 RKECEGDLGYHSSNRERFLNEKIRPEALGLETSTLVMPXSS-FEALLMDLMKNFEIGIQLLLEDGFRGLITLG 904
            RKECEG L Y  SN E+F  +K   +A+G+     V   +S ++A+L D M+N E+GI  LLEDG   LI  G
Sbjct:  336 RKECEGKLCYDFSNLEKFFGDKAVRQAIGVGDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLEDGINVLIYAG 408          
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: CBP3_ORYSJ (Serine carboxypeptidase 3 OS=Oryza sativa subsp. japonica GN=CBP3 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.841e-92
Identity = 80/124 (64.52%), Postives = 98/124 (79.03%), Query Frame = 1
Query:  307 EHPQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPCIQYKEYTEYALNMRLXQTSDYESINKLIPTCEHAIXNCESDGGDACSSSYXCLHSIFNKXXGIAGDVN 678
            +HP++AKNDF+ITGESYAGHYIPAFASRVH+GNKA +GIHINLKGFAIGNGLTDP IQYK YT+YAL+M L + SDY+ INK IP CE AI  C ++G  +C ++Y   +SIF+    + G  N
Sbjct:  201 KHPEFAKNDFFITGESYAGHYIPAFASRVHQGNKANEGIHINLKGFAIGNGLTDPAIQYKAYTDYALDMNLIKKSDYDRINKFIPPCEFAIKLCGTNGKASCMAAYMVCNSIFSSIMKLVGTKN 324          

HSP 2 Score: 149.058 bits (375), Expect = 1.841e-92
Identity = 66/85 (77.65%), Postives = 73/85 (85.88%), Query Frame = 2
Query:   53 KSHPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQ 307
            K  PVVIWLTGGPGCSSELA+FYENGPF I+NN+SL WN +GWD  SN++FVDQPTGTGFSY+SD  D RHDE GVSNDLY FLQ
Sbjct:  112 KEDPVVIWLTGGPGCSSELAVFYENGPFTISNNMSLAWNKFGWDTISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYSFLQ 196          

HSP 3 Score: 59.6918 bits (143), Expect = 1.841e-92
Identity = 33/73 (45.21%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  689 RKECEGDLGYHSSNRERFLNEKIRPEALGLETSTLVMPXSS-FEALLMDLMKNFEIGIQLLLEDGFRGLITLG 904
            RKECEG L Y  SN E+F  +K   EA+G+     V   ++ ++A+L D M+N E+GI  LLEDG   LI  G
Sbjct:  329 RKECEGKLCYDFSNLEKFFGDKAVKEAIGVGDLEFVSCSTTVYQAMLTDWMRNLEVGIPALLEDGINVLIYAG 401          
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: CBP3_WHEAT (Serine carboxypeptidase 3 OS=Triticum aestivum GN=CBP3 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 9.015e-92
Identity = 79/124 (63.71%), Postives = 95/124 (76.61%), Query Frame = 1
Query:  307 EHPQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPCIQYKEYTEYALNMRLXQTSDYESINKLIPTCEHAIXNCESDGGDACSSSYXCLHSIFNKXXGIAGDVN 678
            +HP++ KNDF+ITGESYAGHYIPAFASRVH+GNK  +G HINLKGFAIGNGLTDP IQYK YT+YAL+M L Q +DY+ INK IP CE AI  C +DG  +C ++Y   +SIFN    + G  N
Sbjct:  201 KHPEFVKNDFFITGESYAGHYIPAFASRVHQGNKKNEGTHINLKGFAIGNGLTDPAIQYKAYTDYALDMNLIQKADYDRINKFIPPCEFAIKLCGTDGKASCMAAYMVCNSIFNSIMKLVGTKN 324          

HSP 2 Score: 148.288 bits (373), Expect = 9.015e-92
Identity = 67/85 (78.82%), Postives = 73/85 (85.88%), Query Frame = 2
Query:   53 KSHPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQ 307
            K  PVVIWLTGGPGCSSELA+FYENGPF IANN+SLVWN +GWD  SN++FVD  TGTGFSY+SD  D RHDE GVSNDLYDFLQ
Sbjct:  112 KEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLVWNKFGWDKISNIIFVDPATGTGFSYSSDDRDTRHDEAGVSNDLYDFLQ 196          

HSP 3 Score: 59.3066 bits (142), Expect = 9.015e-92
Identity = 33/73 (45.21%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  689 RKECEGDLGYHSSNRERFLNEKIRPEALGLETSTLVMPXSS-FEALLMDLMKNFEIGIQLLLEDGFRGLITLG 904
            RKECEG L Y  SN E+F  +K   +A+G+     V   +S ++A+L D M+N E+GI  LLEDG   LI  G
Sbjct:  329 RKECEGKLCYDFSNLEKFFGDKAVRQAIGVGDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLEDGINVLIYAG 401          
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: SCP48_ARATH (Serine carboxypeptidase-like 48 OS=Arabidopsis thaliana GN=SCPL48 PE=2 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 1.876e-83
Identity = 88/165 (53.33%), Postives = 112/165 (67.88%), Query Frame = 1
Query:  307 EHPQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPCIQYKEYTEYALNMRLXQTSDYESINKLIPTCEHAIXNCESDG--GDACSSSYXCLHSIFNKXXGIAGDVN-ITISKRM*RGLGLPLLKQGEILE*ENQTGSSRVGDIDF 792
            EHPQ+ KNDFYITGESYAGHYIPA ASRVH+GNK K+G HINLKGFAIGNGLT+P IQY  Y +YAL+M L   SD++++N+   TC+ +I  C +DG  GDAC+SSY   ++IF K   IAG+VN   + K+    L          L  ++   +  VGDI+F
Sbjct:  216 EHPQFVKNDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYALDMNLITQSDHDNLNRYYATCQQSIKECSADGGEGDACASSYTVCNNIFQKIMDIAGNVNYYDVRKQCEGSLCYDFSNMENFLNQKSVRKALGVGDIEF 380          

HSP 2 Score: 158.688 bits (400), Expect = 1.876e-83
Identity = 69/87 (79.31%), Postives = 80/87 (91.95%), Query Frame = 2
Query:   50 NKSHPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQS 310
            NK+ PVVIWLTGGPGCSSELALFYENGPF ++NN SL WN++GWD ASNL++VDQP GTGFSYTSD+ D+RHDE+GVSNDLYDFLQ+
Sbjct:  126 NKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSLSWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEDGVSNDLYDFLQA 212          
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: SCP49_ARATH (Serine carboxypeptidase-like 49 OS=Arabidopsis thaliana GN=SCPL49 PE=2 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 3.489e-82
Identity = 87/164 (53.05%), Postives = 109/164 (66.46%), Query Frame = 1
Query:  304 AEHPQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPCIQYKEYTEYALNMRLXQTSDYESINKLIPTCEHAIXNCESDGGDACSSSYXCLHSIFNKXXGIAGDVN-ITISKRM*RGLGLPLLKQGEILE*ENQTGSSRVGDIDF 792
            AEHP+ AKNDFYITGESYAGHYIPAFASRVHKGNKA +G+HINLKGFAIGNGLTDP +QY  Y +YAL M L    +++ + K++P CE +I  C +DG  +C +SY   +S+F+     AG VN   I K+    L        + L  ++   S  VGDIDF
Sbjct:  213 AEHPKLAKNDFYITGESYAGHYIPAFASRVHKGNKANEGVHINLKGFAIGNGLTDPALQYPAYPDYALEMGLITQKEHDRLEKIVPLCELSIKLCGTDGTTSCLASYLVCNSLFSGVMSHAGGVNYYDIRKKCVGSLCYDFSNMEKFLNLQSVRKSLGVGDIDF 376          

HSP 2 Score: 155.992 bits (393), Expect = 3.489e-82
Identity = 69/86 (80.23%), Postives = 76/86 (88.37%), Query Frame = 2
Query:   53 KSHPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQS 310
            K  PVVIWLTGGPGCSSELA+FYENGPF I +N+SL WN+YGWD  SNLL+VDQP GTGFSYT+DK DIRHDE GVSNDLYDFLQ+
Sbjct:  125 KDAPVVIWLTGGPGCSSELAVFYENGPFKITSNMSLAWNEYGWDQVSNLLYVDQPVGTGFSYTTDKSDIRHDETGVSNDLYDFLQA 210          
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: CBPX_ORYSJ (Serine carboxypeptidase-like OS=Oryza sativa subsp. japonica GN=CBP31 PE=2 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 1.441e-80
Identity = 89/163 (54.60%), Postives = 107/163 (65.64%), Query Frame = 1
Query:  307 EHPQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPCIQYKEYTEYALNMRLXQTSDYESINKLIPTCEHAIXNCESDGGDACSSSYXCLHSIFNKXXGIAGDVN-ITISKRM*RGLGLPLLKQGEILE*ENQTGSSRVGDIDF 792
            EHP +AKNDFYITGESYAGHYIPAFASRV+KGNK  +GIHINLKGFAIGNGLTDP IQYK YT+Y+L+M L   S +  INK++PTCE AI  C + G  +C  +Y   + IF+    I G  N   I K     L   L    + L+ ++   S  VGDI F
Sbjct:  133 EHPNFAKNDFYITGESYAGHYIPAFASRVYKGNKNSEGIHINLKGFAIGNGLTDPAIQYKAYTDYSLDMGLITKSQFNRINKIVPTCELAIKLCGTSGTISCLGAYVVCNLIFSSIETIIGKKNYYDIRKPCVGSLCYDLSNMEKFLQLKSVRESLGVGDIQF 295          

HSP 2 Score: 153.295 bits (386), Expect = 1.441e-80
Identity = 69/89 (77.53%), Postives = 78/89 (87.64%), Query Frame = 2
Query:   44 SINKSHPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQS 310
            S  +  PVVIWLTGGPGCSSELALFYENGPFHIA+N+SLVWND+GWD  SNL++VDQPTGTGFSY+S+  D RHDE GVSNDLY FLQ+
Sbjct:   41 SKGEDDPVVIWLTGGPGCSSELALFYENGPFHIADNMSLVWNDFGWDQESNLIYVDQPTGTGFSYSSNPRDTRHDEAGVSNDLYAFLQA 129          
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: SCP47_ARATH (Serine carboxypeptidase-like 47 OS=Arabidopsis thaliana GN=SCPL47 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.007e-72
Identity = 81/163 (49.69%), Postives = 98/163 (60.12%), Query Frame = 1
Query:  307 EHPQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPCIQYKEYTEYALNMRLXQTSDYESINKLIPTCEHAIXNCESDGGDACSSSYXCLHSIFNKXXGIAGDVN-ITISKRM*RGLGLPLLKQGEILE*ENQTGSSRVGDIDF 792
            EHP++ KNDF+ITGESYAGHYIPA ASRVH GNK K+GI INLKGFAIGNGLT+P IQY  Y +YAL M+L   SD+ES+ +    C++    C   GG  C S+     SIFNK       +N   I K+    L     +    L  EN   +  VGDI F
Sbjct:  213 EHPKFVKNDFFITGESYAGHYIPALASRVHSGNKKKEGIPINLKGFAIGNGLTNPEIQYGAYGDYALQMKLISESDHESLKQDYVECQNITKKCSLGGGLVCDSAVEVCTSIFNKIVAKKSGLNYYDIRKKCVGSLCYDFSRMEIFLNKENVRKALGVGDIKF 375          

HSP 2 Score: 147.132 bits (370), Expect = 1.007e-72
Identity = 63/83 (75.90%), Postives = 75/83 (90.36%), Query Frame = 2
Query:   62 PVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQS 310
            PVVIWLTGGPGCSS +A+FYENGPF I+ +LSL WND+GWD  SN+++VDQP GTGFSYTSD+ DIR+DE+GVSNDLYDFLQ+
Sbjct:  127 PVVIWLTGGPGCSSSVAMFYENGPFKISKDLSLYWNDFGWDKVSNIIYVDQPVGTGFSYTSDESDIRNDEDGVSNDLYDFLQA 209          
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: SCPL1_DICDI (Serine carboxypeptidase S10 family member 1 OS=Dictyostelium discoideum GN=DDB_G0291912 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.429e-36
Identity = 42/86 (48.84%), Postives = 57/86 (66.28%), Query Frame = 2
Query:   62 PVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQSILN 319
            P+++WLTGGPGCSS +A FYENGP+ + +NL+L  N   W+  +N+L+VD P G GFSY  D D     E  +S +LY FL   L+
Sbjct:   55 PLILWLTGGPGCSSLMAAFYENGPYFVNDNLTLSENPNSWNMVANVLYVDSPLGAGFSYVVDSDGYSTTETEISENLYSFLTQFLS 140          

HSP 2 Score: 77.0258 bits (188), Expect = 1.429e-36
Identity = 45/127 (35.43%), Postives = 70/127 (55.12%), Query Frame = 1
Query:  301 LAEHPQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPCIQYKEYTEYALNMRLXQTSDYESINKLIPTCEHAIXNCESDGGDACSSSYXCLHSIFNKXXGIAGDVNI 681
            L+++P+Y+K   YI GESYAGHY+P+F+  +++ N       INLKG AIGNG+ DP IQY     +A    +   +  +    L  +C+ AI     D GD   ++  C ++I +     AG+ N+
Sbjct:  139 LSKYPKYSKLPLYIFGESYAGHYVPSFSYYIYQKNLGL--ATINLKGLAIGNGMVDPYIQYGSLGPFAYAHGMLDINALKETEGLYESCQQAI-----DSGDYNMTTQIC-NNIMDIVQEYAGNFNV 257          
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: SCP54_ARATH (Putative serine carboxypeptidase-like 54 OS=Arabidopsis thaliana GN=SCPL54 PE=5 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.509e-32
Identity = 43/87 (49.43%), Postives = 52/87 (59.77%), Query Frame = 2
Query:   50 NKSHPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQS 310
            N S PVVIWL+GGPGCSS    +                    +   SNL++VDQP  TGFSY +D  D+RHDE+ VSNDLYDFLQ+
Sbjct:   59 NSSDPVVIWLSGGPGCSSSNQRYIS------------------YLKISNLIYVDQPIRTGFSYANDSTDLRHDEDSVSNDLYDFLQA 127          

HSP 2 Score: 77.411 bits (189), Expect = 1.509e-32
Identity = 35/44 (79.55%), Postives = 38/44 (86.36%), Query Frame = 1
Query:  307 EHPQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLK 438
            EHP  AK+DFYITGESYAGHYIPA ASRVH GN+ K+GI INLK
Sbjct:  131 EHPNLAKDDFYITGESYAGHYIPALASRVHNGNEKKEGIVINLK 174          
BLAST of EY659491 vs. ExPASy Swiss-Prot
Match: CPVL_PONAB (Probable serine carboxypeptidase CPVL OS=Pongo abelii GN=CPVL PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.946e-30
Identity = 36/81 (44.44%), Postives = 52/81 (64.20%), Query Frame = 2
Query:   62 PVVIWLTGGPGCSSELALFYENGPFHIANNLSLVWNDYGWDFASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFL 304
            PVV+WL GGPG SS   LF E+GP+ + +N++L   D+ W    ++L++D P GTGFS+T D      +E+ V+ DLY  L
Sbjct:  103 PVVLWLQGGPGFSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVAQDLYSAL 183          

HSP 2 Score: 70.8626 bits (172), Expect = 4.946e-30
Identity = 37/88 (42.05%), Postives = 49/88 (55.68%), Query Frame = 1
Query:  313 PQYAKNDFYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPCIQYKEYTEYALNMRLXQTSDYESINKLIPTC-EH 573
            P+Y  NDFY+TGESYAG Y+PA A  +H  N  ++ + INLKG AIG+G +DP      Y E+   + L      +   K    C EH
Sbjct:  191 PEYKNNDFYVTGESYAGKYVPAIAHLIHSLNPVRE-VKINLKGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEH 277          
The following BLAST results are available for this feature:
BLAST of EY659491 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
CBP3_HORVU1.413e-9262.90Serine carboxypeptidase 3 OS=Hordeum vulgare GN=CB... [more]
CBP3_ORYSJ1.841e-9264.52Serine carboxypeptidase 3 OS=Oryza sativa subsp. j... [more]
CBP3_WHEAT9.015e-9263.71Serine carboxypeptidase 3 OS=Triticum aestivum GN=... [more]
SCP48_ARATH1.876e-8353.33Serine carboxypeptidase-like 48 OS=Arabidopsis tha... [more]
SCP49_ARATH3.489e-8253.05Serine carboxypeptidase-like 49 OS=Arabidopsis tha... [more]
CBPX_ORYSJ1.441e-8054.60Serine carboxypeptidase-like OS=Oryza sativa subsp... [more]
SCP47_ARATH1.007e-7249.69Serine carboxypeptidase-like 47 OS=Arabidopsis tha... [more]
SCPL1_DICDI1.429e-3648.84Serine carboxypeptidase S10 family member 1 OS=Dic... [more]
SCP54_ARATH1.509e-3249.43Putative serine carboxypeptidase-like 54 OS=Arabid... [more]
CPVL_PONAB4.946e-3044.44Probable serine carboxypeptidase CPVL OS=Pongo abe... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-G02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659491 ID=EY659491|Name=EY659491|organism=Citrus sinensis|type=EST|length=976bp
ACATAACCGACCCATNCGTCCGGATCTACTCTTGCTTTGAATCAGTATCA
ACAAAAGCCATCCAGTTGTTATATGGCTGACTGGAGGGCCAGGATGCAGC
AGTGAACTGGCATTGTTCTATGAAAATGGCCCTTTCCACATTGCTAACAA
CTTGTCTCTTGTCTGGAATGACTATGGCTGGGACTTTGCATCGAACCTTC
TATTTGTCGATCAGCCAACTGGAACCGGTTTCAGCTATACCTCAGACAAG
GACGACATTAGACATGATGAAGAAGGCGTTAGCAATGACCTTTATGACTT
CTTGCAGAGCATCCTCAATATGCTAAAAATGACTTTTACATCACTGGAGA
ATCGTACGCTGGGCATTACATTCCTGCTTTTGCTTCCCGGGTTCACAAAG
GAAACAAAGCAAAACAAGGAATTCATATCAACCTTAAGGGTTTTGCTATT
GGTAATGGCTTAACTGATCCATGCATACAGTACAAAGAATACACCGAATA
TGCTTTGAACATGAGATTAANTCAAACATCTGACTATGAGAGTATCAACA
AGTTGATACCAACGTGCGAACATGCAATANNNAACTGTGAGTCTGATGGG
GGAGATGCTTGTTCATCTTCATATGNCTGTTTGCACAGCATATTTAACAA
GATNNCTGGGATTGCTGGTGATGTAAATATTACNATATCGAAAAGAATGT
GAAGGGGACTTGGGCTACCACTCCTCAAACAGGGAGAGATTCTTGAATGA
GAAAATCAGACCGGAAGCTCTAGGGTTGGAGACATCGACTTTGGTCATGC
CGTGNTCCAGTTTTGAGGCACTGCTGATGGACCTGATGAAGAATTTTGAA
ATTGGAATCCAACTCCTTCTGGAGGATGGATTCAGGGGCCTAATTACCCT
GGGAAATTGACCTTAATGGAACCGGGCTGGAATATCTAAGGGGGTCATGC
CTAGGAATGGGCGGCCAAAAAAATAG
back to top