EY659450

Overview
NameEY659450
Unique NameEY659450
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length942
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659450_ssr818 microsatellite EY659450_ssr818:818..829. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX3_ORYSJ (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 3.696e-85
Identity = 115/150 (76.67%), Postives = 133/150 (88.67%), Query Frame = 1
Query:   52 ALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDR 501
            A PVVD EY+ E+++ARRDLRALIA K+CAPIMLRLAWHDAGTYD  TKTGGPNGSIR  +EYSH +N G+KIA+D  E +K KHPKITYADLYQLAGVVAVEVTGGPT+D+VPGR+DS  SP+EGRLPDAK+GA HLR++FYRMGLSD+
Sbjct:    3 AAPVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIRFPQEYSHAANAGIKIAIDLLEPMKQKHPKITYADLYQLAGVVAVEVTGGPTIDYVPGRRDSSDSPEEGRLPDAKKGAAHLREVFYRMGLSDK 152          

HSP 2 Score: 91.6633 bits (226), Expect = 3.696e-85
Identity = 45/73 (61.64%), Postives = 50/73 (68.49%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESEXXXXXXXXXXXXXXXEFRRYGELYAK 716
            +DIVALSGGHTLG+A PERS FDG WT++PLKFDNSYF+ELL   SE                FRRY ELYAK
Sbjct:  152 KDIVALSGGHTLGKARPERSGFDGAWTKDPLKFDNSYFIELLKENSEGLLKLPTDKALVEDPTFRRYVELYAK 224          
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX3_ORYSI (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 8.204e-85
Identity = 114/150 (76.00%), Postives = 133/150 (88.67%), Query Frame = 1
Query:   52 ALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDR 501
            A PVVD EY+ E+++ARRDLRALIA K+CAPIMLRLAWHDAGTYD  TKTGGPNGSIR  +EYSH +N G+KIA+D  E +K +HPKITYADLYQLAGVVAVEVTGGPT+D+VPGR+DS  SP+EGRLPDAK+GA HLR++FYRMGLSD+
Sbjct:    3 AAPVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIRFPQEYSHAANAGIKIAIDLLEPMKQRHPKITYADLYQLAGVVAVEVTGGPTIDYVPGRRDSSDSPEEGRLPDAKKGAAHLREVFYRMGLSDK 152          

HSP 2 Score: 91.6633 bits (226), Expect = 8.204e-85
Identity = 45/73 (61.64%), Postives = 50/73 (68.49%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESEXXXXXXXXXXXXXXXEFRRYGELYAK 716
            +DIVALSGGHTLG+A PERS FDG WT++PLKFDNSYF+ELL   SE                FRRY ELYAK
Sbjct:  152 KDIVALSGGHTLGKARPERSGFDGAWTKDPLKFDNSYFIELLKENSEGLLKLPTDKALVEDPTFRRYVELYAK 224          
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX3_ARATH (L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.693e-69
Identity = 130/169 (76.92%), Postives = 144/169 (85.21%), Query Frame = 1
Query:   49 MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDR-I*WHSQGAILWEGHIQR 552
            MA P+VD EYLKEI KARR+LR+LIA KNCAPIMLRLAWHDAGTYD  +KTGGPNGSIRNEEE++HG+N+GLKIALD CE VKAKHPKITYADLYQLAGVVAVEVTGGP + FVPGRKDS + PKEGRLPDAK+G  HLRD+FYRMGLSD+ I   S G  L   H +R
Sbjct:    1 MAAPIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTLGRAHPER 169          

HSP 2 Score: 104.375 bits (259), Expect = 1.001e-21
Identity = 52/73 (71.23%), Postives = 54/73 (73.97%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESEXXXXXXXXXXXXXXXEFRRYGELYAK 716
            +DIVALSGGHTLGRAHPERS FDGPWT+EPLKFDNSYFVELL GESE               EFRR  ELYAK
Sbjct:  151 KDIVALSGGHTLGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYAK 223          
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX4_ORYSJ (Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 2.070e-67
Identity = 127/169 (75.15%), Postives = 143/169 (84.62%), Query Frame = 1
Query:   49 MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDR-I*WHSQGAILWEGHIQR 552
            MA PVVD EYL+++D+ARR LRALI+ K CAPIMLRLAWHDAGTYDVNTKTGG NGSIR EEEY+HGSN GLKIA+D  E +KAK PKITYADLYQLAGVVAVEVTGGPTV+F+PGR+DS + P+EGRLPDAK+GA HLRDIFYRMGLSD+ I   S G  L   H +R
Sbjct:    1 MAAPVVDAEYLRQVDRARRHLRALISSKGCAPIMLRLAWHDAGTYDVNTKTGGANGSIRYEEEYTHGSNAGLKIAIDLLEPIKAKSPKITYADLYQLAGVVAVEVTGGPTVEFIPGRRDSSVCPREGRLPDAKKGALHLRDIFYRMGLSDKDIVALSGGHTLGRAHPER 169          

HSP 2 Score: 97.4413 bits (241), Expect = 1.224e-19
Identity = 47/73 (64.38%), Postives = 53/73 (72.60%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESEXXXXXXXXXXXXXXXEFRRYGELYAK 716
            +DIVALSGGHTLGRAHPERS F+G WT+EPLKFDNSYF+ELL GESE                FRRY +LYA+
Sbjct:  151 KDIVALSGGHTLGRAHPERSGFEGAWTQEPLKFDNSYFLELLKGESEGLLKLPTDKALLEDPSFRRYVDLYAR 223          
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX1_ORYSJ (L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 4.756e-64
Identity = 89/149 (59.73%), Postives = 113/149 (75.84%), Query Frame = 1
Query:   58 PVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIF-YRMGLSDR 501
            PVV  EY + ++KAR+ LRALIA K+CAP+MLRLAWH AGT+DV++KTGGP G+++   E SH +N GL IA+   E +K + P I+YAD YQLAGVVAVEV+GGP V F PGR+D    P EGRLPDA +G+ HLR +F  +MGLSD+
Sbjct:    6 PVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQ 154          

HSP 2 Score: 84.7297 bits (208), Expect = 4.756e-64
Identity = 42/72 (58.33%), Postives = 46/72 (63.89%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESEXXXXXXXXXXXXXXXEFRRYGELYA 713
            QDIVALSGGHTLGR H ERS F+GPWTR PL+FDNSYF ELL+G+ E                FR   E YA
Sbjct:  154 QDIVALSGGHTLGRCHKERSGFEGPWTRNPLQFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFRPLVEKYA 225          
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX1_ORYSI (L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.054e-63
Identity = 89/149 (59.73%), Postives = 113/149 (75.84%), Query Frame = 1
Query:   58 PVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIF-YRMGLSDR 501
            PVV  EY + ++KAR+ LRALIA K+CAP+MLRLAWH AGT+DV++KTGGP G+++   E SH +N GL IA+   E +K + P I+YAD YQLAGVVAVEV+GGP V F PGR+D    P EGRLPDA +G+ HLR +F  +MGLSD+
Sbjct:    6 PVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQ 154          

HSP 2 Score: 83.5741 bits (205), Expect = 1.054e-63
Identity = 37/47 (78.72%), Postives = 41/47 (87.23%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESE 638
            QDIVALSGGHTLGR H ERS F+GPWTR PL+FDNSYF ELL+G+ E
Sbjct:  154 QDIVALSGGHTLGRCHKERSGFEGPWTRNPLQFDNSYFTELLSGDKE 200          
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX1_PEA (L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 8.812e-63
Identity = 88/149 (59.06%), Postives = 112/149 (75.17%), Query Frame = 1
Query:   58 PVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYR-MGLSDR 501
            P V  +Y K I+KA+R LR  IA K CAP++LRLAWH AGT+D  TKTGGP G+I+++ E +HG+NNGL IA+   E +K + P ++YAD YQLAGVVAVE+TGGP V F PGR+D    P EGRLPDA +G+ HLRD+F + MGLSD+
Sbjct:    6 PTVSPDYQKAIEKAKRKLRGFIAEKKCAPLILRLAWHSAGTFDSKTKTGGPFGTIKHQAELAHGANNGLDIAVRLLEPIKEQFPIVSYADFYQLAGVVAVEITGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQ 154          

HSP 2 Score: 78.5666 bits (192), Expect = 8.812e-63
Identity = 40/72 (55.56%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESEXXXXXXXXXXXXXXXEFRRYGELYA 713
            QDIVALSGGHT+G AH ERS F+GPWT  PL FDNSYF ELL GE +                FR   E YA
Sbjct:  154 QDIVALSGGHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLTGEKDGLLQLPSDKALLTDSVFRPLVEKYA 225          
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX2_ARATH (L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3)

HSP 1 Score: 181.415 bits (459), Expect = 1.046e-60
Identity = 86/148 (58.11%), Postives = 108/148 (72.97%), Query Frame = 1
Query:   58 PVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDR 501
            P V  EY K + + +R LR LIA K+CAPI+LRLAWH AGT+DV TKTGGP G+IR+ +E +H +NNGL IA+   + +K   P ++YAD YQLAGVVAVE+TGGP + F PGR D    P EGRLP A +G  HLRD+F RMGL+D+
Sbjct:    7 PEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDK 154          

HSP 2 Score: 74.3294 bits (181), Expect = 1.046e-60
Identity = 34/47 (72.34%), Postives = 38/47 (80.85%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESE 638
            +DIVALSGGHTLGR H ERS F+G WT  PL FDNSYF E+L+GE E
Sbjct:  154 KDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKE 200          
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX2_ORYSJ (L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.046e-60
Identity = 88/149 (59.06%), Postives = 111/149 (74.50%), Query Frame = 1
Query:   58 PVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIF-YRMGLSDR 501
            P V  EYL  + KA+R LR LIA KNCAP+MLRLAWH AGT+DV+++TGGP G+++N  E SH +N GL IA+   + +K + P ++YAD YQLAGVVAVEVTGGP V F PGR+D    P EGRLPDA +G+ HLR +F  +MGLSD+
Sbjct:    7 PTVSDEYLAAVGKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSAQMGLSDK 155          

HSP 2 Score: 76.2554 bits (186), Expect = 1.046e-60
Identity = 39/72 (54.17%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESEXXXXXXXXXXXXXXXEFRRYGELYA 713
            +DIVALSGGHTLGR H ERS F+G WT  PL FDNSYF EL++GE E                FR   E YA
Sbjct:  155 KDIVALSGGHTLGRCHKERSGFEGAWTSNPLIFDNSYFTELVSGEKEGLLQLPSDKALMADPAFRPLVEKYA 226          
BLAST of EY659450 vs. ExPASy Swiss-Prot
Match: APX1_ARATH (L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 1.936e-59
Identity = 84/149 (56.38%), Postives = 111/149 (74.50%), Query Frame = 1
Query:   58 PVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYR-MGLSDR 501
            P V  +Y K ++K RR LR LIA KNCAPIM+RLAWH AGT+D  ++TGGP G++R + E +HG+N+G+ IAL   + ++ + P I++AD +QLAGVVAVEVTGGP + F PGR+D    P EGRLPDA +G  HLRD+F + MGLSD+
Sbjct:    6 PTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGREDKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDK 154          

HSP 2 Score: 72.7886 bits (177), Expect = 1.936e-59
Identity = 38/72 (52.78%), Postives = 42/72 (58.33%), Query Frame = 3
Query:  498 QDIVALSGGHTLGRAHPERSCFDGPWTREPLKFDNSYFVELLNGESEXXXXXXXXXXXXXXXEFRRYGELYA 713
            +DIVALSG HTLGR H +RS F+G WT  PL FDNSYF ELL+GE E                FR   E YA
Sbjct:  154 KDIVALSGAHTLGRCHKDRSGFEGAWTSNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPLVEKYA 225          
The following BLAST results are available for this feature:
BLAST of EY659450 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
APX3_ORYSJ3.696e-8576.67Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]
APX3_ORYSI8.204e-8576.00Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]
APX3_ARATH1.693e-6976.92L-ascorbate peroxidase 3, peroxisomal OS=Arabidops... [more]
APX4_ORYSJ2.070e-6775.15Probable L-ascorbate peroxidase 4 OS=Oryza sativa ... [more]
APX1_ORYSJ4.756e-6459.73L-ascorbate peroxidase 1, cytosolic OS=Oryza sativ... [more]
APX1_ORYSI1.054e-6359.73L-ascorbate peroxidase 1, cytosolic OS=Oryza sativ... [more]
APX1_PEA8.812e-6359.06L-ascorbate peroxidase, cytosolic OS=Pisum sativum... [more]
APX2_ARATH1.046e-6058.11L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis... [more]
APX2_ORYSJ1.046e-6059.06L-ascorbate peroxidase 2, cytosolic OS=Oryza sativ... [more]
APX1_ARATH1.936e-5956.38L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-C06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659450 ID=EY659450|Name=EY659450|organism=Citrus sinensis|type=EST|length=942bp
CGACAGCTGTCGTAAACTGTCAAAGGTCGTTACACAAAAAGAGCTCCGAT
GGCTTTACCGGTCGTTGACACAGAGTACCTGAAGGAGATCGACAAGGCTC
GTCGCGATCTCCGCGCTCTTATCGCTTACAAGAACTGTGCTCCAATCATG
CTCCGTCTAGCGTGGCACGACGCGGGAACATATGACGTGAACACGAAGAC
TGGTGGACCAAATGGCTCGATAAGGAACGAAGAGGAGTACTCTCATGGCT
CCAACAATGGCTTGAAAATCGCTCTTGATTTTTGTGAGGAAGTGAAGGCT
AAACATCCAAAAATAACATATGCAGACCTATACCAGCTTGCGGGTGTTGT
TGCAGTTGAGGTCACTGGAGGTCCTACAGTCGACTTTGTTCCTGGTAGAA
AGGATTCAAAAATTTCTCCCAAGGAAGGGCGTCTTCCAGATGCCAAACGA
GGTGCACCTCATCTGAGGGATATCTTTTATCGGATGGGTCTGTCTGACAG
GATATAGTGGCACTCTCAGGGGGCCATACTTTGGGAAGGGCACATCCAGA
GAGATCATGTTTTGACGGCCCTTGGACCAGGGAGCCTCTGAAATTTGATA
ACTCATACTTTGTGGAGTTGCTGAATGGGGAATCAGAAGGATTACTGGCA
CTTCCAACAGACANGGGCTTATTANAAGACCCTGAGTTCCGTCGTTATGG
TGAGTTGTATGCAAAGGTCAATGCACTTATCTTACCAAATACCCCATGTT
AACAGCGCTTCATTTGATCAAGCCATATATTTATTTCTGGCTGACAGAAC
TTTACTGGGTTTTCCTTTGCTGCTGCTGCAAATTTATGGGATGATCTTTT
AAAAAAAAAAAAAAAAAAAAAAGGGCGGGCCGTTTAAAGGATCAAGCTTC
TTCCCTGCATGGGAGGGATAAGTTTTTTTGGGGCCCCAAATA
back to top