EY659449

Overview
NameEY659449
Unique NameEY659449
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length888
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7481 contig Csv1_Contig7481:1..890. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPE_SPIOL (Ribulose-phosphate 3-epimerase, chloroplastic OS=Spinacia oleracea GN=RPE PE=1 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 3.287e-112
Identity = 208/236 (88.14%), Postives = 217/236 (91.95%), Query Frame = 2
Query:    2 RIFTIVKASARADKFSKSDIIVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLENGVNPWIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKDYAEAIKGIKTSK 709
            ++ T+VKA++R DKFSKSDIIVSPSILSANFAKL EQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCE +STIHLHRT+ QIKSLGAKAGVVLNP T LS IE VLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLR+MC+E GVNPWIEVDGGV P NA   IEAG  AL AGSAVFGAKDYAEAIKGIK SK
Sbjct:   43 KVQTLVKATSRVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCELASTIHLHRTVNQIKSLGAKAGVVLNPGTPLSTIEYVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRKMCVEKGVNPWIEVDGGVTPANAYKVIEAGANALVAGSAVFGAKDYAEAIKGIKASK 278          
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPE_SOLTU (Ribulose-phosphate 3-epimerase, chloroplastic (Fragment) OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 5.607e-112
Identity = 205/236 (86.86%), Postives = 217/236 (91.95%), Query Frame = 2
Query:    2 RIFTIVKASARADKFSKSDIIVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLENGVNPWIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKDYAEAIKGIKTSK 709
            RI T+V AS+R DKFSKSDIIVSPSILSANF+KL EQVKA+E AGCDWIHVDVMDGRFVPNITIGPLVVD+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSSTIHLHRT+ QIKSLGAKAGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVKKISDLR++C E G+NPWIEVDGGVGPKNA   IEAG  AL AGSAVFGA DYAEAIKGIKTSK
Sbjct:   38 RIQTVVNASSRVDKFSKSDIIVSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVVDSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSSTIHLHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVKKISDLRKICAERGLNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAPDYAEAIKGIKTSK 273          
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPE_ORYSJ (Ribulose-phosphate 3-epimerase, chloroplastic OS=Oryza sativa subsp. japonica GN=RPE PE=1 SV=2)

HSP 1 Score: 401.749 bits (1031), Expect = 2.783e-111
Identity = 204/231 (88.31%), Postives = 217/231 (93.94%), Query Frame = 2
Query:   17 VKASARADKFSKSDIIVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLENGVNPWIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKDYAEAIKGIKTSK 709
            V+AS+R DKFSK+DIIVSPSILSANF+KL EQVKAVE+AGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRT+ QIKSLGAKAGVVLNPAT L+AI+ VLDVVDLVLIMSVNPGFGGQSFIESQVKKI++LRR+C E GVNPWIEVDGGVGPKNA   IEAG  A+ AGSAVFGA DYAEAIKGIKTS+
Sbjct:   37 VRASSRVDKFSKNDIIVSPSILSANFSKLGEQVKAVEVAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTVNQIKSLGAKAGVVLNPATPLTAIDYVLDVVDLVLIMSVNPGFGGQSFIESQVKKIAELRRLCAEKGVNPWIEVDGGVGPKNAYKVIEAGANAIVAGSAVFGAPDYAEAIKGIKTSQ 267          
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPE_SYNY3 (Ribulose-phosphate 3-epimerase OS=Synechocystis sp. (strain PCC 6803) GN=rpe PE=1 SV=3)

HSP 1 Score: 289.271 bits (739), Expect = 2.013e-77
Identity = 144/218 (66.06%), Postives = 175/218 (80.28%), Query Frame = 2
Query:   56 DIIVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLENGVNPWIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKDYAEAIKGIKTSK 709
            +I+V+PSILSA+F++L E++KAV+ AG DWIHVDVMDGRFVPNITIGPL+VDA+RP+T   LDVHLMIVEPE+ V DF KAGADI+SVH E +++ HLHRTL QI+ LG KAG VLNP+T L  +E VL V DL+LIMSVNPGFGGQSFI   + KI  LR+MC E G++PWIEVDGG+ P N    +EAG  A+ AGSAVF A +YAEAI G++ SK
Sbjct:    4 NIVVAPSILSADFSRLGEEIKAVDEAGADWIHVDVMDGRFVPNITIGPLIVDAIRPLTKKTLDVHLMIVEPEKYVEDFAKAGADIISVHVEHNASPHLHRTLCQIRELGKKAGAVLNPSTPLDFLEYVLPVCDLILIMSVNPGFGGQSFIPEVLPKIRALRQMCDERGLDPWIEVDGGLKPNNTWQVLEAGANAIVAGSAVFNAPNYAEAIAGVRNSK 221          
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPE_BACSU (Ribulose-phosphate 3-epimerase OS=Bacillus subtilis GN=rpe PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.389e-62
Identity = 131/218 (60.09%), Postives = 157/218 (72.02%), Query Frame = 2
Query:   59 IIVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLENGVNP-WIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKDYAEAIKGIKTSK 709
            I V+PSILSA+FA L  ++K VE  G D IH+DVMDG FVPNITIGPL+V+A+RPVTDLPLDVHLMI EP++ +P F KAGADI+SVH E  +  HLHRT+  IK  G KAGVVLNP T +  IE V D +DLVL+M+VNPGFGGQ FI S + KI +++RM  E G     IEVDGGV  + A   IEAG   L AGSAV+G  D  +AI  I+ SK
Sbjct:    2 IKVAPSILSADFAALGNEIKDVEKGGADCIHIDVMDGHFVPNITIGPLIVEAVRPVTDLPLDVHLMIEEPDRYIPAFAKAGADILSVHAE--ACPHLHRTIQLIKEQGVKAGVVLNPHTPVQVIEHVFDDLDLVLLMTVNPGFGGQKFIHSVLPKIKEVKRMADEKGKKDLLIEVDGGVNKETAPLVIEAGANLLVAGSAVYGQSDRKKAISEIRGSK 217          
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPEP_RALEH (Ribulose-phosphate 3-epimerase, plasmid OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEP PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.319e-49
Identity = 107/221 (48.42%), Postives = 142/221 (64.25%), Query Frame = 2
Query:   47 SKSDIIVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLR----RMCLENGVNPWIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKDYAEAIKGI 697
            S+  I ++PSILSA+FA+L E+V A+E  G D +H DVMD  +V N+TIGPLV +A+RP+  +P+DVHLM+   +  +P F KAGA+++S H E S   H+ RT+  I+  G KAG+VLNPAT LS ++  LD +DLVL+MSVNPGFGGQ+FI   + K+   R    R     G   W+E+DGGV   N      AG     AGSAVFGA D     +GI
Sbjct:   12 SQRAIRLAPSILSADFARLGEEVCAIEAGGADLVHFDVMDNHYVSNLTIGPLVCEAIRPLVSIPIDVHLMVEPVDALIPMFAKAGANLISFHPEASR--HVDRTIGLIRDHGCKAGLVLNPATPLSWLDHTLDKLDLVLLMSVNPGFGGQAFIPGVLDKVRQARARIDRQVAAGGRPVWLEIDGGVKADNITEIARAGADTFVAGSAVFGAPDADGGYRGI 230          
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPEC_RALEH (Ribulose-phosphate 3-epimerase, chromosomal OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEC PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 5.167e-49
Identity = 106/213 (49.77%), Postives = 139/213 (65.26%), Query Frame = 2
Query:   47 SKSDIIVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLR----RMCLENGVNPWIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKD 673
            S+  I ++PSILSA+FA+L E+V A+E  G D +H DVMD  +VPN+TIGPLV +A+RP+  +P+DVHLM+   +  +P F KAGA+I+S H E S   H+ RT+  I+  G KAG+VLNPAT L  ++  LD +DLVL+MSVNPGFGGQ+FI   + K+   R    R     G   W+E+DGGV   N      AG     AGSAVFGA D
Sbjct:   12 SQRAIRLAPSILSADFARLGEEVCAIEAGGADLVHFDVMDNHYVPNLTIGPLVCEAIRPLVSIPIDVHLMVEPVDALIPLFAKAGANIISFHPEASR--HVDRTIGLIRDHGCKAGLVLNPATPLGWLDHTLDQLDLVLLMSVNPGFGGQAFIPGVLDKVRQARARIDRQVDAGGRPVWLEIDGGVKADNIAAIARAGADTFVAGSAVFGAPD 222          
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPE_HAEIN (Ribulose-phosphate 3-epimerase OS=Haemophilus influenzae GN=rpe PE=3 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 3.703e-47
Identity = 103/215 (47.91%), Postives = 140/215 (65.12%), Query Frame = 2
Query:   62 IVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPV-TDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLENGVNPWIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKDYAEAIKGIKT 703
            +++PSILSA+ A+L + V+ V  AG D IH DVMD  +VPN+T GP V  ALR      P+DVHLM+   ++ +PDF KAGA+ ++ H E S   H+ R+L  I+  G K+G+V NPA  LS ++ VLD VD+VL+MSVNPGFGGQSFI + +KK+   R++  E+G +  +EVDGGV   N      AG     AGSA+FG  DY + I  I+T
Sbjct:    5 LIAPSILSADLARLGDDVQNVLNAGADVIHFDVMDNHYVPNLTFGPAVCQALRDYGITAPIDVHLMVKPVDRIIPDFAKAGANYITFHPESSE--HIDRSLQLIRDCGCKSGLVFNPAMPLSYLDYVLDKVDVVLLMSVNPGFGGQSFIPATLKKLQQARKIIDESGYDIRLEVDGGVKVDNIAEIAAAGADMFVAGSAIFGKPDYKQVIDQIRT 217          
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPE_SERMA (Ribulose-phosphate 3-epimerase OS=Serratia marcescens GN=rpe PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.077e-46
Identity = 101/206 (49.03%), Postives = 136/206 (66.02%), Query Frame = 2
Query:   62 IVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPV-TDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLENGVNPWIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKDY 676
            +++PSILSA+FA+L E    V  AG D +H DVMD  +VPN+TIGP+V +ALR      P+DVHLM+   ++ VPDF KAGA  +S H E S   H+ RT+  IK  G KAG+V NPAT LS ++ V+D +D++L+MSVNPGFGGQSFI   + K+  +R++  ++G +  +EVDGGV   N      AG     AGSA+FG  DY
Sbjct:    5 LIAPSILSADFARLGEDTANVLAAGGDVVHFDVMDNHYVPNLTIGPMVCEALRNYGITAPIDVHLMVKPVDRIVPDFAKAGASYISFHPEASE--HVDRTIQLIKEHGCKAGLVFNPATPLSYLDYVMDKIDVILLMSVNPGFGGQSFIHGTLDKLRQVRKLIDDSGRDIRLEVDGGVKVDNIAEIAAAGADMFVAGSAIFGQPDY 208          
BLAST of EY659449 vs. ExPASy Swiss-Prot
Match: RPE_AQUAE (Ribulose-phosphate 3-epimerase OS=Aquifex aeolicus GN=rpe PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.077e-46
Identity = 100/216 (46.30%), Postives = 140/216 (64.81%), Query Frame = 2
Query:   62 IVSPSILSANFAKLVEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLTQIKSLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLENGVNP--WIEVDGGVGPKNAX*XIEAGRYALGAGSAVFGAKDYAEAIKGIKT 703
            +++PSIL+ ++  + EQ++A    G D +H DVMDG FVPNIT G  ++  +R    LP+D HLMI  P++ +P F++AGA+ +SVH E  +  H+HRTL  IK LGAKAGVV+NP TSLSAIE  L   D VL+MSVNPGF GQ FIE  ++++  L+ M   + +NP   IE+DGG+   N    + AG   +  GS +FGAKD     + +K+
Sbjct:    3 LLAPSILAGDWWCIGEQIQATIRGGADILHYDVMDGHFVPNITAGYEILSHIRKRASLPIDAHLMIENPDKYIPKFVEAGANWISVHIE--NNYHIHRTLQLIKELGAKAGVVVNPGTSLSAIEEALYYADYVLLMSVNPGFSGQKFIERSIERLRILKEM--RDRINPSCLIEIDGGIKENNIAEVVRAGADVVVVGSGIFGAKDIEAQTRKLKS 214          
The following BLAST results are available for this feature:
BLAST of EY659449 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
RPE_SPIOL3.287e-11288.14Ribulose-phosphate 3-epimerase, chloroplastic OS=S... [more]
RPE_SOLTU5.607e-11286.86Ribulose-phosphate 3-epimerase, chloroplastic (Fra... [more]
RPE_ORYSJ2.783e-11188.31Ribulose-phosphate 3-epimerase, chloroplastic OS=O... [more]
RPE_SYNY32.013e-7766.06Ribulose-phosphate 3-epimerase OS=Synechocystis sp... [more]
RPE_BACSU2.389e-6260.09Ribulose-phosphate 3-epimerase OS=Bacillus subtili... [more]
RPEP_RALEH2.319e-4948.42Ribulose-phosphate 3-epimerase, plasmid OS=Ralston... [more]
RPEC_RALEH5.167e-4949.77Ribulose-phosphate 3-epimerase, chromosomal OS=Ral... [more]
RPE_HAEIN3.703e-4747.91Ribulose-phosphate 3-epimerase OS=Haemophilus infl... [more]
RPE_SERMA1.077e-4649.03Ribulose-phosphate 3-epimerase OS=Serratia marcesc... [more]
RPE_AQUAE1.077e-4646.30Ribulose-phosphate 3-epimerase OS=Aquifex aeolicus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-C05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659449 ID=EY659449|Name=EY659449|organism=Citrus sinensis|type=EST|length=888bp
GAGAATTTTTACTATAGTGAAGGCATCAGCTCGCGCGGATAAGTTCTCGA
AAAGTGATATTATTGTTTCTCCATCTATTCTCTCTGCTAATTTCGCGAAG
TTAGTCGAGCAGGTAAAAGCAGTGGAATTGGCTGGTTGTGATTGGATTCA
TGTTGATGTCATGGATGGTCGTTTTGTTCCAAACATTACAATTGGACCTC
TTGTGGTTGATGCTTTGCGCCCTGTGACAGACCTTCCTTTGGATGTTCAT
TTGATGATTGTCGAACCTGAACAACGAGTGCCTGATTTTATCAAGGCTGG
AGCTGACATAGTCAGCGTCCACTGTGAGCAATCATCCACTATTCATTTGC
ACCGCACTCTTACCCAAATAAAAAGTTTGGGAGCTAAAGCTGGAGTTGTC
CTCAACCCTGCTACCTCACTGAGTGCAATAGAATGTGTCCTTGATGTGGT
TGATCTTGTCTTGATCATGTCGGTGAACCCTGGCTTTGGTGGGCAAAGCT
TTATTGAGAGCCAAGTAAAAAAAATCTCAGACTTGAGAAGAATGTGTTTA
GAGAATGGAGTAAACCCATGGATTGAAGTAGATGGTGGAGTAGGTCCGAA
AAATGCATANTAGGNTATTGAAGCTGGGCGCTATGCCTTGGGTGCTGGTT
CAGCTGTCTTTGGAGCTAAAGATTATGCTGAAGCTATAAAGGGAATAAAA
ACCAGCAAAGGCCANAAGCAGTTGCAGTGTGAACAGATGATTACAAAAGG
ACTGATTAGATTCATTCTGCAGTATCTGTATCACCCACCTATGCCCAGTA
ATTANTCGCCTATTGCTTGGTCATGTCGTTGGCAGAATCATCTCCCTTCT
GGGGCGGTCCCTGTTGTTGGGGAGGTACTATAAAAATC
back to top