EY659444

Overview
NameEY659444
Unique NameEY659444
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length917
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11032 contig Csv1_Contig11032:347..1263. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: PUB34_ARATH (U-box domain-containing protein 34 OS=Arabidopsis thaliana GN=PUB34 PE=2 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 3.592e-109
Identity = 181/267 (67.79%), Postives = 228/267 (85.39%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLISDAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAIKNGSFADILDKSITDWPLAETEELACIALKCSNLKCRDRPDLDTEVMPVLRKLKDVADACVKLESXHVYAPSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWL*ETHVSPVTKLRLQHLSI 803
            VYEYL  GSL +YI+H+  KP LPWF+RF++IFEVACGLAFLH+SKPEPIVHRDLKPGNILL+RNYVSKI DVGLAKL++D  PDN+T YR ++LAGTLHY+DPEYHRTGTIRPKSDLYAFG+IILQLLT+  P+G++  VE+A+K G+  ++LDKS+TDWPLAETEELA I LKC+  +CRDRPDL +EV+PVL++L + A++ VK E  ++ APSH+FCPIL+E+ME+P IAADGFTYE +AI AWL + ++SPVT+ +L H  +
Sbjct:  511 VYEYLENGSLEEYIFHRKNKPPLPWFIRFRVIFEVACGLAFLHSSKPEPIVHRDLKPGNILLNRNYVSKIADVGLAKLVTDVAPDNVTMYRNSVLAGTLHYIDPEYHRTGTIRPKSDLYAFGIIILQLLTARNPSGIVPAVENAVKKGTLTEMLDKSVTDWPLAETEELARIGLKCAEFRCRDRPDLKSEVIPVLKRLVETANSKVKKEGSNLRAPSHYFCPILREIMEEPEIAADGFTYERKAILAWLEKHNISPVTRQKLDHFKL 777          
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: PUB53_ARATH (Putative U-box domain-containing protein 53 OS=Arabidopsis thaliana GN=PUB53 PE=3 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 8.358e-74
Identity = 138/274 (50.36%), Postives = 190/274 (69.34%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLI--SDAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAIKNGS---FADILDKSITDWPLAETEELACIALKCSNLKCRDRPDLDTEVMPVLRKLKDVAD-ACVKLESXHVYAPSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWL*ETHVSPVTKLRLQHLSII 806
            VYEY+  GSL D ++  N    +PWFVR +I +EVA  L FLH SKP PI+HRDLKP NILL+ N+VSK+GDVGL+ +I  +D +    T Y++T   GTL Y+DPEY RTG I PKSD+YAFG+IILQLLT      +   VE+A++N +      ILD+   +WP+ ET +LA +AL+C+ L+ +DRPDL+ +++PVL  LK VAD A   L +     PSHFFCP+L++VM++P IAADG+TY+ RAI+ W+     SPVT   LQ+++++
Sbjct:  529 VYEYMENGSLEDRLFQVNDSQPIPWFVRLRIAWEVASALVFLHKSKPTPIIHRDLKPANILLNHNFVSKVGDVGLSTMIQAADPLSTKFTMYKQTSPVGTLCYIDPEYQRTGRISPKSDVYAFGMIILQLLTGQQAMALTYTVETAMENNNDDELIQILDEKAGNWPIEETRQLAALALQCTELRSKDRPDLEDQILPVLESLKKVADKARNSLSAAPSQPPSHFFCPLLKDVMKEPCIAADGYTYDRRAIEEWMENHRTSPVTNSPLQNVNLL 802          
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: PUB35_ARATH (U-box domain-containing protein 35 OS=Arabidopsis thaliana GN=PUB35 PE=1 SV=2)

HSP 1 Score: 265.388 bits (677), Expect = 3.287e-70
Identity = 133/271 (49.08%), Postives = 181/271 (66.79%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLIS-DAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAI-KNGSFADILDKSITDWPLAETEELACIALKCSNLKCRDRPDLDTEVMPVLRKLKDVAD-ACVKLESXHVYAPSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWL*ETHVSPVTKLRLQHLSII 806
            VYEY+  GSL D ++  N  P LPWF RF+I +EVA  L FLH SKP+PI+HRDLKP NILLD N+VSK+GDVGL+ ++  D +    T Y++T   GTL Y+DPEY RTG I  KSD+Y+FG+I+LQLLT+     +   VESA+  N  F  ILD+   +WP+ ET ELA +AL C+ L+ +DRPDL  +++P L  LK VA+ A           P+HF CP+L++VM +P +AADG+TY+  AI+ WL E + SP+T   L   +++
Sbjct:  549 VYEYMENGSLEDRLFQVNNSPPLPWFERFRIAWEVAAALVFLHKSKPKPIIHRDLKPANILLDHNFVSKVGDVGLSTMVQVDPLSTKFTIYKQTSPVGTLCYIDPEYQRTGRISSKSDIYSFGMILLQLLTAKPAIALTHFVESAMDSNDEFLKILDQKAGNWPIEETRELAALALCCTELRGKDRPDLKDQILPALENLKKVAEKARNSFSGVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRHAIEEWLKEHNTSPMTDSPLHSKNLL 819          
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: PUB52_ARATH (U-box domain-containing protein 52 OS=Arabidopsis thaliana GN=PUB52 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 4.608e-70
Identity = 133/271 (49.08%), Postives = 180/271 (66.42%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLISDAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAI-KNGSFADILDKSITDWPLAETEELACIALKCSNLKCRDRPDLDTEVMPVLRKLKDVADACVKLESXHVYA-PSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWL*ETHVSPVTKLRLQHLSIIS 809
            VYEY+  GSL D +   N  P +PWF RF+I  EVA  L FLH SKP PI+HRDLKPGNILLD N+VSK+GDVGL+ +++     + T +++T   GTL Y+DPEY RTG I PKSD+Y+ GV+ILQL+T+     +   VE AI  +  F  ILDK    WP+++T ELA + L C+ ++ RDRPDL  +++P L +L+ VAD    L S      PSHF CP+L+ VM +P +AADG+TY+  AI+ WL +   SPVT L L + ++I+
Sbjct:  559 VYEYMDNGSLDDRLMLVNDTPPIPWFERFRIALEVASALVFLHKSKPRPIIHRDLKPGNILLDHNFVSKLGDVGLSTMVNQDDVSSRTIFKQTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEFMAILDKKAGSWPISDTRELAALGLCCTEMRRRDRPDLKDQIIPALERLRKVADKAQNLLSRTPSGPPSHFICPLLKGVMNEPCVAADGYTYDREAIEEWLRQKDTSPVTNLPLPNKNLIA 829          

HSP 2 Score: 22.3274 bits (46), Expect = 4.608e-70
Identity = 8/13 (61.54%), Postives = 10/13 (76.92%), Query Frame = 2
Query:  809 NYTLXSXIQQWES 847
            NYTL S I +W+S
Sbjct:  830 NYTLYSAIMEWKS 842          
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: PUB51_ARATH (U-box domain-containing protein 51 OS=Arabidopsis thaliana GN=PUB51 PE=2 SV=2)

HSP 1 Score: 264.233 bits (674), Expect = 7.322e-70
Identity = 133/273 (48.72%), Postives = 183/273 (67.03%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGK------PALPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLISDAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAIKN--GSFADILDKSITDWPLAETEELACIALKCSNLKCRDRPDLDTEVMPVLRKLKDVADA-----CVKLESXHVYAPSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWL*ETHVSPVTKL 782
            VYEY+  GSL + +  +         P L WF RF+I +E+A  L FLH ++P PIVHRDLKP NILLDRN VSKIGDVGL+K+++       T + ET   GT  Y+DPEY RTG + P+SD+YAFG+I+LQL+T+    G+   +E A+++  G F +ILDK+  DWP+ E +E+  I L+C+ ++ RDRPDL  E++PVL +LK+VA          L   H  AP+HF+CPI ++VME+P +A+DG+TYE RAIK WL + H SP+T L
Sbjct:  498 VYEYMHNGSLEERLMKRRPNVDTPQPPPLRWFERFRIAWEIASALYFLHTNEPRPIVHRDLKPANILLDRNNVSKIGDVGLSKMVNLDPSHASTVFNETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHSIEKALRDQTGKFTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVASIARNMFADNLIDHHHNAPTHFYCPITKDVMENPCVASDGYTYEKRAIKEWLQKNHKSPMTDL 770          
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: PUB33_ARATH (U-box domain-containing protein 33 OS=Arabidopsis thaliana GN=PUB33 PE=2 SV=2)

HSP 1 Score: 220.705 bits (561), Expect = 9.284e-57
Identity = 118/273 (43.22%), Postives = 165/273 (60.44%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLISDAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAIKNGSFADILDKSITDWPLAETEELACIALKCSNLKCRDRPDLDTEVMPVLRKLKDVADACVKL---ESXHVYAPSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWL*ETH-VSPVTKLRLQHLSIIS 809
            VYEYL  GSL D +  ++  P L W  R +I  E+   L FLH++K   +VH DLKP NILLD N VSK+ D G   L+      N ++   T + GT+ Y+DPE   +G + PKSD+Y+FG+I+L+LLT      +  +V+ A+ NG+  D+LD    DWP  + E+LA +AL+C      +RPDL TEV  VL  ++  +          + H  AP +F CPI QEVM+DP++AADGFTYE  AI+AWL   H  SP+T ++L H S+I+
Sbjct:  550 VYEYLPGGSLEDRLTCKDNSPPLSWQNRVRIATEICAALVFLHSNKAHSLVHGDLKPANILLDSNLVSKLSDFGTCSLLHP----NGSKSVRTDVTGTVAYLDPEASSSGELTPKSDVYSFGIILLRLLTGRPALRISNEVKYALDNGTLNDLLDPLAGDWPFVQAEQLARLALRCCETVSENRPDLGTEVWRVLEPMRASSGGSSSFHLGRNEHRIAPPYFICPIFQEVMQDPHVAADGFTYEAEAIRAWLDSEHDTSPMTNVKLSHTSLIA 818          
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: PUB32_ARATH (U-box domain-containing protein 32 OS=Arabidopsis thaliana GN=PUB32 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 2.145e-45
Identity = 109/277 (39.35%), Postives = 157/277 (56.68%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLISDAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAIKNGSFADILDKSITDWPLAETEELACIALKCSNLKCRDRPDLDTEVMPVLRKLKDVADACVKLESXHVYA--------PSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWL*ETH-VSPVTKLRLQHLSII 806
            +Y+Y+  GSL D    +N  PAL W  R +I  E+   L FLH++ P  I+H +LKP  ILLD N V+KI D G+++LI     D    +           +DP Y  +  +  +SD+YAFG+I+LQLLT    +G+L  V+ A++N + + +LD S  DWP+A  ++LA +A++C      +RPDL      VLR +  +    V       YA        PSH+ CPI QEVM+DP IAADGFTYE  AI+ WL   H  SP+T L+++  ++I
Sbjct:  529 IYQYIPNGSLEDCFSSENNVPALSWESRIRIASEICSALLFLHSNIP-CIIHGNLKPSKILLDSNLVTKINDYGISQLIPIDGLDKSDPH-----------VDPHYFVSREMTLESDIYAFGIILLQLLTRRPVSGILRDVKCALENDNISAVLDNSAGDWPVARGKKLANVAIRCCKKNPMNRPDLAV----VLRFIDRMKAPEVPSSETSSYANQNVPRRPPSHYLCPIFQEVMKDPLIAADGFTYEAEAIREWLANGHDTSPMTNLKMEDCNLI 789          
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: PUB50_ARATH (Putative U-box domain-containing protein 50 OS=Arabidopsis thaliana GN=PUB50 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.335e-32
Identity = 103/283 (36.40%), Postives = 140/283 (49.47%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGKPA----LPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLISDAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAIKNGSFADILDKSITDWPLAETEELACIALKCSNLKCRDRPDLDT-EVMPVLRKLKDVADACVKLESXHVYA-------------PSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWL*ETH-VSPVTKLRLQH 794
            ++EY+  G+L D ++    K      L W  R +I  +V  GL FLH+ KP+PIVH  L P  ILLDRN V KI   GL                          M  +   T     K D+ AFGV++L LLT    +G LLK  S  +     D LD++   WPL   +E   +A+KCS++      D  T E+M  L K+++ AD   K +  +  A             PS F CPILQEVM++P++AADGF+YE  AI+ WL   H  SP+T LRL +
Sbjct:  490 LFEYMHNGNLRDNLFTSQRKSRRSKILKWHDRIRIAHQVCSGLGFLHSVKPKPIVHGRLTPSKILLDRNLVPKITGFGLI-------------------------MHSDQSDT-----KPDVMAFGVLLLHLLTGRNWHG-LLKAMSMNQTSILRD-LDQTAGKWPLELAKEFGALAVKCSSVNRGGNMDFSTKEIMEELGKIREKADE-FKTKGGYEEATNSNMDEGDPNDIPSVFMCPILQEVMKNPHVAADGFSYELEAIQEWLSMGHDTSPMTNLRLDY 739          

HSP 2 Score: 21.1718 bits (43), Expect = 4.335e-32
Identity = 8/13 (61.54%), Postives = 9/13 (69.23%), Query Frame = 2
Query:  809 NYTLXSXIQQWES 847
            N+TL S IQ W S
Sbjct:  745 NHTLRSLIQDWHS 757          
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: WAK2_ARATH (Wall-associated receptor kinase 2 OS=Arabidopsis thaliana GN=WAK2 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.155e-29
Identity = 79/209 (37.80%), Postives = 119/209 (56.94%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLISDAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTS----CL-----PNGVLLKVESAIKNGSFADILDKSI-TDWPLAETEELACIALKCSNLKCRDRPDLDTEVMPVLRKLK 599
            VYE++  G+L D+++      +L W  R +I  EVA  LA+LH+S   PI+HRD+K  NILLD+N  +K+ D G ++LI         E   TI+ GTL Y+DPEY+ TG +  KSD+Y+FGV++++LL+     C      P  ++    SA KN  F +I+D  +  +    E +E A IA +C+ L   +RP +  EV   L  L+
Sbjct:  476 VYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLI-----PMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRM-KEVAAELEALR 678          
BLAST of EY659444 vs. ExPASy Swiss-Prot
Match: WAK3_ARATH (Wall-associated receptor kinase 3 OS=Arabidopsis thaliana GN=WAK3 PE=2 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.545e-27
Identity = 81/228 (35.53%), Postives = 121/228 (53.07%), Query Frame = 3
Query:    3 VYEYLXKGSLGDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPEPIVHRDLKPGNILLDRNYVSKIGDVGLAKLISDAIPDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTS----CLPNGVLLK------VESAIKNGSFADILDKSITDWPLAETEELACIALKCSNLKCRDRPDLDTEVMPVLRKLKDVADACVKLESXHVYAPSH 656
            VYE++  G+L D+++      +L W  R +I  EVA  LA+LH+S   PI+HRD+K  NILLD N  +K+ D G +KLI         E   T++ GTL Y+DPEY+ TG +  KSD+Y+FGV++++LL+     C       K      V +  +N     I D+ + +  L E +E A IA +C+ L   +RP           ++K+VA    KLE+  V    H
Sbjct:  487 VYEFITNGTLFDHLHGSIFDSSLTWEHRLRIAIEVAGTLAYLHSSASIPIIHRDIKTANILLDENLTAKVADFGASKLI-----PMDKEQLTTMVQGTLGYLDPEYYTTGLLNEKSDVYSFGVVLMELLSGQKALCFERPQASKHLVSYFVSATEENRLHEIIDDQVLNEDNLKEIQEAARIAAECTRLMGEERP-----------RMKEVA---AKLEALRVEKTKH 695          
The following BLAST results are available for this feature:
BLAST of EY659444 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 278
Match NameE-valueIdentityDescription
PUB34_ARATH3.592e-10967.79U-box domain-containing protein 34 OS=Arabidopsis ... [more]
PUB53_ARATH8.358e-7450.36Putative U-box domain-containing protein 53 OS=Ara... [more]
PUB35_ARATH3.287e-7049.08U-box domain-containing protein 35 OS=Arabidopsis ... [more]
PUB52_ARATH4.608e-7049.08U-box domain-containing protein 52 OS=Arabidopsis ... [more]
PUB51_ARATH7.322e-7048.72U-box domain-containing protein 51 OS=Arabidopsis ... [more]
PUB33_ARATH9.284e-5743.22U-box domain-containing protein 33 OS=Arabidopsis ... [more]
PUB32_ARATH2.145e-4539.35U-box domain-containing protein 32 OS=Arabidopsis ... [more]
PUB50_ARATH4.335e-3236.40Putative U-box domain-containing protein 50 OS=Ara... [more]
WAK2_ARATH2.155e-2937.80Wall-associated receptor kinase 2 OS=Arabidopsis t... [more]
WAK3_ARATH1.545e-2735.53Wall-associated receptor kinase 3 OS=Arabidopsis t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-B11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659444 ID=EY659444|Name=EY659444|organism=Citrus sinensis|type=EST|length=917bp
TGGTTTATGAATACCTGGNAAAAGGAAGCCTCGGAGACTATATTTACCAT
CAGAATGGGAAGCCTGCTCTTCCTTGGTTTGTTCGGTTCCAGATAATTTT
TGAAGTAGCCTGTGGACTTGCATTCTTACACAACTCAAAGCCAGAGCCTA
TTGTGCATCGAGACTTGAAACCGGGAAACATCTTGTTAGACAGAAATTAT
GTGAGCAAAATTGGGGATGTTGGGCTGGCTAAACTCATTTCAGATGCCAT
ACCTGACAACATCACAGAGTACAGAGAGACCATTCTTGCTGGTACTCTTC
ATTACATGGACCCAGAATATCACAGAACCGGCACTATTCGTCCCAAATCT
GATCTATATGCATTTGGAGTTATTATACTCCAGTTATTGACATCTTGCCT
TCCGAATGGAGTTCTACTGAAAGTTGAAAGTGCCATTAAGAATGGTTCCT
TTGCTGACATTTTAGACAAGTCAATAACAGATTGGCCGCTTGCTGAAACA
GAGGAATTAGCTTGCATTGCATTAAAGTGTTCAAATCTTAAATGCAGGGA
TAGACCTGATCTTGATACCGAAGTCATGCCGGTTCTCAGGAAACTCAAGG
ATGTTGCAGATGCTTGTGTAAAGTTGGAAAGCAGNCATGTTTATGCACCA
AGCCACTTCTTCTGTCCAATCCTTCAGGAAGTCATGGAAGATCCATACAT
TGCTGCTGATGGATTTACTTATGAGCATAGAGCAATCAAGGCATGGCTTT
GAGAAACACATGTATCTCCAGTGACAAAGCTTAGGCTTCAGCATTTGTCA
ATTATTTCAACTACACACTGCNGTCTGNCATTCAGCAATGGGAGTCACCT
GTGACATCTCTGTAAAGATAGTTGAATGGGTCCCCTTTTATTNCTTGNAT
CCTTCATGCCTATCAGA
back to top