EY659443

Overview
NameEY659443
Unique NameEY659443
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length398
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7759 contig Csv1_Contig7759:729..1125. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659443 vs. ExPASy Swiss-Prot
Match: EF1B_ORYSJ (Elongation factor 1-beta OS=Oryza sativa subsp. japonica GN=Os07g0662500 PE=1 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 5.475e-14
Identity = 37/40 (92.50%), Postives = 39/40 (97.50%), Query Frame = 2
Query:    8 IMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 127
            IMLTIVDDLVSVD+LIEEHL EEPINE+VQSCDIVAFNKI
Sbjct:  185 IMLTIVDDLVSVDSLIEEHLTEEPINEFVQSCDIVAFNKI 224          
BLAST of EY659443 vs. ExPASy Swiss-Prot
Match: EF1D_BETVU (Elongation factor 1-delta OS=Beta vulgaris PE=2 SV=3)

HSP 1 Score: 71.2478 bits (173), Expect = 1.761e-12
Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 2
Query:    2 IVIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 127
            + IM+TIVDDLVSVD LIE++L  EPINEYVQSCDIVAFNKI
Sbjct:  190 LTIMMTIVDDLVSVDNLIEDYLTVEPINEYVQSCDIVAFNKI 231          
BLAST of EY659443 vs. ExPASy Swiss-Prot
Match: EF1D2_ARATH (Elongation factor 1-delta 2 OS=Arabidopsis thaliana GN=At2g18110 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.004e-12
Identity = 34/40 (85.00%), Postives = 36/40 (90.00%), Query Frame = 2
Query:    8 IMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 127
            IM TIVDDLVS+DT+IEE L  EPINEYVQSCDIVAFNKI
Sbjct:  192 IMCTIVDDLVSIDTMIEEQLTVEPINEYVQSCDIVAFNKI 231          
BLAST of EY659443 vs. ExPASy Swiss-Prot
Match: EF1D1_ARATH (Elongation factor 1-delta 1 OS=Arabidopsis thaliana GN=At1g30230 PE=2 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 6.693e-12
Identity = 33/40 (82.50%), Postives = 36/40 (90.00%), Query Frame = 2
Query:    8 IMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 127
            I+ TIVDDLVS+DT+IEE L  EPINEYVQSCDIVAFNKI
Sbjct:  192 ILCTIVDDLVSIDTMIEEQLTVEPINEYVQSCDIVAFNKI 231          
BLAST of EY659443 vs. ExPASy Swiss-Prot
Match: EF1D_PIMBR (Elongation factor 1-delta OS=Pimpinella brachycarpa PE=2 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 1.142e-11
Identity = 32/40 (80.00%), Postives = 36/40 (90.00%), Query Frame = 2
Query:    8 IMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 127
            IMLTIVDDLVSVD L+E++L  EP NEY+QSCDIVAFNKI
Sbjct:  187 IMLTIVDDLVSVDDLVEDYLTAEPANEYIQSCDIVAFNKI 226          
BLAST of EY659443 vs. ExPASy Swiss-Prot
Match: EF1D1_ORYSJ (Elongation factor 1-delta 1 OS=Oryza sativa subsp. japonica GN=Os07g0614500 PE=2 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 2.543e-11
Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = 2
Query:    8 IMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 127
            IM+TIVDDLVSVD+LIE++   EP NEY+QSCDIVAFNKI
Sbjct:  190 IMMTIVDDLVSVDSLIEDYFYTEPANEYIQSCDIVAFNKI 229          
BLAST of EY659443 vs. ExPASy Swiss-Prot
Match: EF1B1_ARATH (Elongation factor 1-beta 1 OS=Arabidopsis thaliana GN=At5g12110 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 2.543e-11
Identity = 32/42 (76.19%), Postives = 36/42 (85.71%), Query Frame = 2
Query:    2 IVIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 127
            + IM+TIVDDLVSVD LIE+HL  EP NEY+QS DIVAFNKI
Sbjct:  187 LTIMMTIVDDLVSVDNLIEDHLTSEPNNEYIQSVDIVAFNKI 228          
BLAST of EY659443 vs. ExPASy Swiss-Prot
Match: EF1D2_ORYSJ (Elongation factor 1-delta 2 OS=Oryza sativa subsp. japonica GN=Os03g0406200 PE=2 SV=3)

HSP 1 Score: 65.855 bits (159), Expect = 7.400e-11
Identity = 30/40 (75.00%), Postives = 36/40 (90.00%), Query Frame = 2
Query:    8 IMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 127
            IM+TIVDDLVSVD+LIE++   EP NE++QSCDIVAFNKI
Sbjct:  187 IMMTIVDDLVSVDSLIEDYFYTEPANEFIQSCDIVAFNKI 226          
The following BLAST results are available for this feature:
BLAST of EY659443 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
EF1B_ORYSJ5.475e-1492.50Elongation factor 1-beta OS=Oryza sativa subsp. ja... [more]
EF1D_BETVU1.761e-1280.95Elongation factor 1-delta OS=Beta vulgaris PE=2 SV... [more]
EF1D2_ARATH3.004e-1285.00Elongation factor 1-delta 2 OS=Arabidopsis thalian... [more]
EF1D1_ARATH6.693e-1282.50Elongation factor 1-delta 1 OS=Arabidopsis thalian... [more]
EF1D_PIMBR1.142e-1180.00Elongation factor 1-delta OS=Pimpinella brachycarp... [more]
EF1D1_ORYSJ2.543e-1177.50Elongation factor 1-delta 1 OS=Oryza sativa subsp.... [more]
EF1B1_ARATH2.543e-1176.19Elongation factor 1-beta 1 OS=Arabidopsis thaliana... [more]
EF1D2_ORYSJ7.400e-1175.00Elongation factor 1-delta 2 OS=Oryza sativa subsp.... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659443 ID=EY659443|Name=EY659443|organism=Citrus sinensis|type=EST|length=398bp
AATTGTTATAATGCTTACAATTGTGGATGACTTGGTGTCTGTTGACACCC
TCATTGAGGAACACCTGCTGGAAGAACCAATTAATGAATATGTCCAGAGC
TGTGATATTGTAGCCTTCAACAAAATCTAATTTGTGGATCCTTTGGCAAA
GTGGGTGCTAGAGAGGCTTCCGGGGATTTTGTCTTGGATAATGATCATAG
CAAAGTGATATTTATTTTATAATTTTTATTTTTGTTTCAGGAGTCTTGTG
TGTTCCATTATGGATTTGTTCTTCTATGGATGCTGGNCTCTTTGGAGTTT
TTTAACTGTGACTGAAGTTGGTATGCTATATCTGCAATGCAGAACTCTTT
AGAGCATTAATGATTGAGAGCGGCTTTGCCCAAAAAAAAAAAAAAAAA
back to top