EY659441

Overview
NameEY659441
Unique NameEY659441
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length926
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 1433D_SOYBN (14-3-3-like protein D OS=Glycine max GN=GF14D PE=2 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 5.389e-113
Identity = 205/243 (84.36%), Postives = 219/243 (90.12%), Query Frame = 3
Query:   66 MAPSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDGD 794
            M  SK+RENFVY+AKLAEQAERY+EMV++MKNVA LDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEE KGNE+NAKRIKEYRQKVE ELS+ICND+M VIDEHLIPSA+AGESTVF+YKMKGDYYRYLAEFK G+EKKEAA  SMK           DLPPTHPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQL R +LTLWTSDI  DG+
Sbjct:    1 MTASKDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMRVIDEHLIPSAAAGESTVFYYKMKGDYYRYLAEFKSGNEKKEAADQSMKAYESATAAAEADLPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPEDGE 243          
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 1433B_VICFA (14-3-3-like protein B OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 2.264e-111
Identity = 201/243 (82.72%), Postives = 219/243 (90.12%), Query Frame = 3
Query:   66 MAPSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDGD 794
            MA +K+RENFVY+AKLAEQAERY+EMVD+MKNVA LDVELT+EERNLLSVGYKNVIGARRASWRILSSIEQKEE+KGN+VNAKRIKEYR KVE+ELS+IC D+M VIDEHLIPSA+AGESTVF+YKMKGDYYRYLAEFK G+EKKEA   SMK           +LPPTHPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQL R +LTLWTSDI  DG+
Sbjct:    1 MASTKDRENFVYIAKLAEQAERYEEMVDSMKNVANLDVELTIEERNLLSVGYKNVIGARRASWRILSSIEQKEESKGNDVNAKRIKEYRHKVETELSNICIDVMRVIDEHLIPSAAAGESTVFYYKMKGDYYRYLAEFKTGNEKKEAGDQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPEDGE 243          
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 1433C_SOYBN (14-3-3-like protein C OS=Glycine max GN=GF14C PE=2 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.794e-108
Identity = 199/243 (81.89%), Postives = 219/243 (90.12%), Query Frame = 3
Query:   66 MAPSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDGD 794
            MA +KERENFVYVAKLAEQAERY+EMV+AMKNVA L+VELTVEERNLLSVGYKNV+GARRASWRILSSIEQKEEAKGN+V+ KRIKEYR KVESELS+IC+DIMTVIDE+LIPS+S+GE +VFFYKMKGDYYRYLAEFK GDE+KEAA +SMK           +L  THPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAISELDTL+EESYKDSTLIMQL R +LTLWTSDI  DG+
Sbjct:    1 MASTKERENFVYVAKLAEQAERYEEMVEAMKNVANLNVELTVEERNLLSVGYKNVVGARRASWRILSSIEQKEEAKGNDVSVKRIKEYRLKVESELSNICSDIMTVIDEYLIPSSSSGEPSVFFYKMKGDYYRYLAEFKSGDERKEAADHSMKAYQLASTTAEAELASTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGE 243          
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 14339_SOLLC (14-3-3 protein 9 OS=Solanum lycopersicum GN=TFT9 PE=2 SV=2)

HSP 1 Score: 389.423 bits (999), Expect = 1.519e-107
Identity = 195/243 (80.25%), Postives = 215/243 (88.48%), Query Frame = 3
Query:   66 MAPSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDGD 794
            MA SKERENFVYVAKLAEQAERYDEMV+AMKNVA +DVELTVEERNLLSVGYKNV+G+RRASWRILSSIEQKEE++GNE N KRIKEY QKVESEL++ICNDIM VID+HLIPS SAGESTVF++KMKGDYYRYLAEFK G++KKE A  S+K           +L PTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELD+LNE+SYKDSTLIMQL R +LTLWTSD+  D +
Sbjct:    1 MASSKERENFVYVAKLAEQAERYDEMVEAMKNVANMDVELTVEERNLLSVGYKNVVGSRRASWRILSSIEQKEESRGNEQNVKRIKEYLQKVESELTNICNDIMVVIDQHLIPSCSAGESTVFYHKMKGDYYRYLAEFKAGNDKKEVAELSLKAYQAATTAAEAELAPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDSLNEDSYKDSTLIMQLLRDNLTLWTSDLPEDAE 243          
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 14338_SOLLC (14-3-3 protein 8 OS=Solanum lycopersicum GN=TFT8 PE=2 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 1.856e-105
Identity = 191/243 (78.60%), Postives = 213/243 (87.65%), Query Frame = 3
Query:   66 MAPSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDGD 794
            MA SKERE+ VY+A+LAEQAERYDEMVDAMKNVA LDVELTVEERNLLSVGYKNV+G+RRASWRILSSIEQKE+A+GNE N KRI+ YRQKVESEL+DICN+IMTVIDEHLIPS +AGESTVF+YKMKGDYYRYLAEFK GD+KKE +  S+K           +LP THPIRLGLALNFSVFYYEIMNSPERAC LAKQ FDEAISELD+LNE++YKD TLI+QL R +LTLWTSDI  DG+
Sbjct:    1 MASSKERESLVYIARLAEQAERYDEMVDAMKNVANLDVELTVEERNLLSVGYKNVVGSRRASWRILSSIEQKEDARGNEQNVKRIQGYRQKVESELTDICNNIMTVIDEHLIPSCTAGESTVFYYKMKGDYYRYLAEFKTGDDKKEVSDLSLKAYQTATTTAEAELPITHPIRLGLALNFSVFYYEIMNSPERACQLAKQVFDEAISELDSLNEDNYKDGTLILQLLRDNLTLWTSDIPEDGE 243          
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 14339_ARATH (14-3-3-like protein GF14 mu OS=Arabidopsis thaliana GN=GRF9 PE=1 SV=2)

HSP 1 Score: 375.17 bits (962), Expect = 2.964e-103
Identity = 189/242 (78.10%), Postives = 210/242 (86.78%), Query Frame = 3
Query:   66 MAPSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDG 791
            M   KER+ FVY+AKL+EQAERY+EMV++MK+VAKL+V+LTVEERNLLSVGYKNVIG+RRASWRI SSIEQKE  KGN+VN KRIKEY +KVE ELS+IC DIM+V+DEHLIPSAS GESTVFF KMKGDYYRYLAEFK G+E+KEAA  S+K            LPPTHPIRLGLALNFSVFYYEIMN+PERACHLAKQAFDEAISELDTLNEESYKDSTLIMQL R +LTLWTSDI  +G
Sbjct:    1 MGSGKERDTFVYLAKLSEQAERYEEMVESMKSVAKLNVDLTVEERNLLSVGYKNVIGSRRASWRIFSSIEQKEAVKGNDVNVKRIKEYMEKVELELSNICIDIMSVLDEHLIPSASEGESTVFFNKMKGDYYRYLAEFKSGNERKEAADQSLKAYEIATTAAEAKLPPTHPIRLGLALNFSVFYYEIMNAPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDISEEG 242          
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 14337_SOLLC (14-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 PE=2 SV=2)

HSP 1 Score: 369.777 bits (948), Expect = 1.245e-101
Identity = 182/239 (76.15%), Postives = 210/239 (87.87%), Query Frame = 3
Query:   78 KERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDGD 794
            KERE  VY+A+LAEQAERYDEMV+AMK +AK+DVELTVEERNL+SVGYKNVIGARRASWRILSSIEQKEE+KG+E N KRIK YRQ+VE EL+ IC+DI++VIDEHL+PS++ GESTVF+YKMKGDYYRYLAEFK GD++KEA+  S+K           DL PTHPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAI+ELD+L+EESYKDSTLIMQL R +LTLWTSD+   G+
Sbjct:    3 KEREKQVYLARLAEQAERYDEMVEAMKAIAKMDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGHEQNVKRIKTYRQRVEDELTKICSDILSVIDEHLVPSSTTGESTVFYYKMKGDYYRYLAEFKAGDDRKEASEQSLKAYEAATATASSDLAPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLSEESYKDSTLIMQLLRDNLTLWTSDLEEGGE 241          
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 14312_ARATH (14-3-3-like protein GF14 iota OS=Arabidopsis thaliana GN=GRF12 PE=2 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 2.124e-101
Identity = 183/244 (75.00%), Postives = 209/244 (85.66%), Query Frame = 3
Query:   60 SAMAPSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDG 791
            S+    KERE FVY+AKL+EQAERYDEMV+ MK VA+++ ELTVEERNLLSVGYKNVIGARRASWRI+SSIEQKEE+KGNE N K+IK YRQKVE EL++IC DI+T+ID+HLIP A++GE+TVF+YKMKGDYYRYLAEFK   E+KEAA  S+K           +LP THPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAI+ELDTL+EESYKDSTLIMQL R +LTLWTSD+  DG
Sbjct:    2 SSSGSDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGNESNVKQIKGYRQKVEDELANICQDILTIIDQHLIPHATSGEATVFYYKMKGDYYRYLAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDLPEDG 245          
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 14310_ARATH (14-3-3-like protein GF14 epsilon OS=Arabidopsis thaliana GN=GRF10 PE=2 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 2.430e-97
Identity = 176/238 (73.95%), Postives = 204/238 (85.71%), Query Frame = 3
Query:   81 ERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDGD 794
            ERE  VY+AKL+EQ ERYDEMV+AMK VA+LDVELTVEERNL+SVGYKNVIGARRASWRILSSIEQKEE+KGN+ N KR+K YR++VE EL+ +CNDI++VID+HLIPS++A ESTVFFYKMKGDYYRYLAEF  G E+KEAA  S++            L PTHP+RLGLALNFSVFYYEI+NSPE AC LAKQAFD+AI+ELD+LNEESYKDSTLIMQL R +LTLWTSD+  +GD
Sbjct:    4 EREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGNDENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVFFYKMKGDYYRYLAEFSSGAERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVFYYEILNSPESACQLAKQAFDDAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLNEEGD 241          
BLAST of EY659441 vs. ExPASy Swiss-Prot
Match: 14311_ARATH (14-3-3-like protein GF14 omicron OS=Arabidopsis thaliana GN=GRF11 PE=2 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.575e-96
Identity = 178/237 (75.11%), Postives = 202/237 (85.23%), Query Frame = 3
Query:   81 ERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLSRXHLTLWTSDIXXDG 791
            ER   VY+AKL EQAERYDEMV+AMK VA LDVELT+EERNLLSVGYKNVIGARRASWRILSSIEQKEE+KGNE NAKRIK+YR KVE ELS IC DI+ VID+HL+P A++GESTVF+YKMKGDY+RYLAEFK G +++EAA  S+K           +L  THPIRLGLALNFSVFYYEI+NSPERACHLAK+AFDEAI+ELD+LNE+SYKDSTLIMQL R +LTLWTSD+   G
Sbjct:    4 ERAKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASWRILSSIEQKEESKGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPFATSGESTVFYYKMKGDYFRYLAEFKSGADREEAADLSLKAYEAATSSASTELSTTHPIRLGLALNFSVFYYEILNSPERACHLAKRAFDEAIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSDLEEGG 240          
The following BLAST results are available for this feature:
BLAST of EY659441 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
1433D_SOYBN5.389e-11384.3614-3-3-like protein D OS=Glycine max GN=GF14D PE=2... [more]
1433B_VICFA2.264e-11182.7214-3-3-like protein B OS=Vicia faba PE=2 SV=1[more]
1433C_SOYBN1.794e-10881.8914-3-3-like protein C OS=Glycine max GN=GF14C PE=2... [more]
14339_SOLLC1.519e-10780.2514-3-3 protein 9 OS=Solanum lycopersicum GN=TFT9 P... [more]
14338_SOLLC1.856e-10578.6014-3-3 protein 8 OS=Solanum lycopersicum GN=TFT8 P... [more]
14339_ARATH2.964e-10378.1014-3-3-like protein GF14 mu OS=Arabidopsis thalian... [more]
14337_SOLLC1.245e-10176.1514-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 P... [more]
14312_ARATH2.124e-10175.0014-3-3-like protein GF14 iota OS=Arabidopsis thali... [more]
14310_ARATH2.430e-9773.9514-3-3-like protein GF14 epsilon OS=Arabidopsis th... [more]
14311_ARATH1.575e-9675.1114-3-3-like protein GF14 omicron OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-B08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659441 ID=EY659441|Name=EY659441|organism=Citrus sinensis|type=EST|length=926bp
CTTCGGTNCCGGNATTCCCGCCTCGACCCACGCGTCCGCCCTAATTTTTT
CCTCGGAGATCGGCCATGGCTCCCTCTAAAGAACGCGAAAACTTCGTCTA
CGTCGCCAAGCTCGCTGAACAAGCCGAGCGCTACGACGAGATGGTGGATG
CGATGAAAAATGTTGCGAAGCTTGATGTGGAATTGACGGTTGAGGAGCGC
AACTTGCTCTCTGTTGGCTACAAGAATGTAATTGGTGCTCGAAGAGCATC
ATGGAGGATACTTTCGTCAATTGAGCAAAAGGAAGAAGCGAAAGGGAATG
AAGTGAATGCGAAGCGGATCAAGGAGTATAGGCAAAAGGTTGAATCTGAA
TTGTCGGACATTTGCAATGATATCATGACTGTCATTGATGAGCATCTTAT
TCCTTCAGCAAGTGCTGGTGAATCAACTGTGTTCTTCTATAAGATGAAAG
GAGATTATTATCGGTACCTTGCTGAATTCAAGTTTGGCGATGAGAAGAAA
GAGGCTGCTGCTAATTCAATGAAAGCGTATGAGACAGCTACCACTGCTGC
AGAGGCTGATTTGCCACCTACACATCCCATCCGATTGGGTTTGGCTCTGA
ATTTCTCTGTCTTTTATTATGAGATCATGAATTCTCCTGAAAGGGCTTGC
CATCTTGCAAAACAAGCTTTTGATGAAGCTATTTCCGAGCTGGACACCCT
CAACGAGGAGTCCTACAAAGACAGCACCTTAATTATGCAGCTTTCTAGGG
NACACCTTACCTTATGGACTTCTGACATTNCANAAGATGGAGATGCCCAN
AAGGGCTATGGCACTGNCAAAGNTGGTGGGGGAGAANATGCANAGTGACC
AGGAGAGCTCGNAGAGTTGCTATGTGATTGGGGGAGAAAAGATGANNACT
GTTAATCAACTTATGGTTGCTAAAGG
back to top