EY659410

Overview
NameEY659410
Unique NameEY659410
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length888
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:136..1023. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 509.99 bits (1312), Expect = 7.256e-144
Identity = 247/252 (98.02%), Postives = 251/252 (99.60%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 272          
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 2.757e-143
Identity = 245/252 (97.22%), Postives = 251/252 (99.60%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+G
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTG 272          
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 6.142e-143
Identity = 245/252 (97.22%), Postives = 251/252 (99.60%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EIVKEVSSYLKKVGYNP+KVPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+G
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTG 272          
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 1.048e-142
Identity = 244/252 (96.83%), Postives = 250/252 (99.21%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+G
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTG 272          
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 504.982 bits (1299), Expect = 2.334e-142
Identity = 244/252 (96.83%), Postives = 250/252 (99.21%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLDALD I+EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+G
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTG 272          
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 504.597 bits (1298), Expect = 3.048e-142
Identity = 244/252 (96.83%), Postives = 250/252 (99.21%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD IN+ KRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+G
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINDAKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTG 272          
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 3.981e-142
Identity = 242/252 (96.03%), Postives = 250/252 (99.21%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+G
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTG 272          
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 6.791e-142
Identity = 244/252 (96.83%), Postives = 250/252 (99.21%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+ FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+G
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTG 272          
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A1_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 6.791e-142
Identity = 244/252 (96.83%), Postives = 247/252 (98.02%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEK+ FVPISGFEGDNMIERSTNLDWYKGPTLLDALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +KPGMVVTFGPSG
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDPTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKPGMVVTFGPSG 272          
BLAST of EY659410 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 3.370e-141
Identity = 241/252 (95.63%), Postives = 249/252 (98.81%), Query Frame = 2
Query:   26 ATTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSG 781
            +TTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIG VPVGRVETGV+KPGM+VTF P+G
Sbjct:   21 STTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGIVPVGRVETGVVKPGMLVTFAPTG 272          
The following BLAST results are available for this feature:
BLAST of EY659410 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ORYSJ7.256e-14498.02Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_SOLLC2.757e-14397.22Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_WHEAT6.142e-14397.22Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A_MANES1.048e-14296.83Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_SOYBN2.334e-14296.83Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_TOBAC3.048e-14296.83Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_ARATH3.981e-14296.03Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_MAIZE6.791e-14296.83Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A1_DAUCA6.791e-14296.83Elongation factor 1-alpha OS=Daucus carota PE=3 SV... [more]
EF1A_VICFA3.370e-14195.63Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-G12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659410 ID=EY659410|Name=EY659410|organism=Citrus sinensis|type=EST|length=888bp
CCACGCGTCCGCGACTCTGGTAAACGCAACCACCACCGGACACTTGATCT
ACAAGCTTGGTGGTATTGACAAGCGTGTGATCGAGAGGTTCGAGAAGGAA
GCTGCTGAGATGAACAAGAGGTCATTCAAGTATGCCTGGGTGCTCGACAA
GCTCAAGGCTGAGCGTGAACGTGGTATTACCATTGATATTGCCTTGTGGA
AGTTCGAGACCACCAAGTACTACTGCACCGTCATTGATGCTCCTGGACAT
CGTGACTTTATCAAGAACATGATTACCGGTACCTCACAGGCTGACTGTGC
CGTCCTTATCATTGACTCCACCACCGGTGGTTTTGAAGCTGGTATCTCCA
AGGATGGTCAGACTCGTGAGCATGCTTTGCTTGCTTTCACCCTTGGTGTG
AAGCAGATGATTTGCTGCTGTAACAAGATGGACGCCACCACCCCCAAGTA
CTCAAAGGCTAGGTACGATGAAATTGTGAAGGAGGTCTCTTCCTACCTGA
AGAAGGTTGGATACAACCCCGAGAAAGTCCCATTCGTGCCCATCTCTGGT
TTCGAGGGTGACAACATGATTGAGAGGTCTACCAACCTTGACTGGTACAA
GGGTCCAACCCTGCTGGATGCTCTTGACAATATCAATGAGCCGAAGAGGC
CCTCAGACAAGCCCCTTCGTCTGCCACTCCAGGACGTGTACAAGATTGGT
GGCATTGGAACCGTCCCAGTGGGTCGCGTTGAGACCGGTGTCCTCAAGCC
TGGTATGGTGGTGACATTTGGCCCCTCTGGATGACAACTGAGGNTAAGTC
TNGTGAGATGCACACGAAGCTCTGCAGGAGGCCCTTCGGGTGACATGNTG
GCTTCACGTGAAGAACGTGCTGTCAAGATCTCAGCGTG
back to top