EY659407

Overview
NameEY659407
Unique NameEY659407
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length865
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUC2_ARATH (Sucrose transport protein SUC2 OS=Arabidopsis thaliana GN=SUC2 PE=1 SV=2)

HSP 1 Score: 295.434 bits (755), Expect = 2.699e-79
Identity = 163/291 (56.01%), Postives = 186/291 (63.92%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTDSVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQRLEEIDDKETAPPTKD------PFFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNS--KGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTKLIDG 861
            ISGM+VQPIVG+HSD C SRFGRRRP                 YAADIGHS GD      KTRAI IF +GFWILD ANNTLQGP RA L DLS  + KKTRTAN+FFSFFMAVGNVLGYAAGSY +L  ++PFT +++CD  CANLKTCFFLS                E+         T  PT D      PFF EIFGA K +++PMW+LL  TALNWIAW P LL DTDWM R+VY  NS    TA   K+YN+ VRA +LGLMLNA  LG  SL V  + + + G
Sbjct:   76 ISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHSMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVSLCYVKEK-------PWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWFPFLLFDTDWMGREVYGGNSDATATAASKKLYNDGVRAGALGLMLNAIVLGFMSLGVEWIGRKLGG 359          
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUC8_ARATH (Sucrose transport protein SUC8 OS=Arabidopsis thaliana GN=SUC8 PE=1 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.340e-78
Identity = 155/288 (53.82%), Postives = 185/288 (64.24%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTDSVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQRLEEIDDKETAPPT-----KDPFFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNSKGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTKLIDG 861
            +SG++VQP VG+ SD C SRFGRRRP                 YAAD GHS GD     VK RA++IF +GFWILD ANNTLQGP RA L DL+    KKTRTAN+FFSFFMAVGNVLGYAAGSYT+L  + PFT +KACD  CANLK+CFFLS                   L  ++DK+ +P       K PFF EIFGA K +++PMW+LL  TALNWIAW P LL DTDWM R+VY  +SKG     K+YN  +   +LGLMLN+  LGI SL +  ++K I G
Sbjct:   77 VSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVAVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTII--------ALWYVEDKQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGIVSLGIEGISKKIGG 356          
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUC9_ARATH (Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 2.285e-78
Identity = 153/286 (53.50%), Postives = 188/286 (65.73%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTDSVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQRLEEIDDKETAPPT-----KDPFFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNSKGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTKLI 855
            ISG++VQP VG+ SD CKSRFGRRRP                 +AAD GH+ GD   ++VK RA+  FV+GFWILD ANNTLQGP RA L DL+    KKTRTAN+ FSFFMAVGNVLGYAAGSYT+L  + PFT +KACD  CANLK+CF +S                   L  ++DK+ +P       K PFF EIFGA K +++PMW+LLA TALNWIAW P LL DTDWM R+VY  +S G     K+YN+ ++  SLGLMLN+  LG+ SL +GV++K I
Sbjct:   77 ISGLLVQPTVGYFSDRCKSRFGRRRPFIATGALLVALAVILIGFAADFGHTMGDKLDEAVKIRAVGFFVVGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAIFSFFMAVGNVLGYAAGSYTNLHKIFPFTVTKACDIYCANLKSCFIISITLLIVLTII--------ALWYVEDKQWSPNADSDNEKTPFFGEIFGAFKVMKRPMWMLLAVTALNWIAWFPFLLYDTDWMGREVYGGDSAGDDKMKKLYNHGIQVGSLGLMLNSIVLGVMSLVIGVISKKI 354          
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUC6_ARATH (Putative sucrose transport protein SUC6 OS=Arabidopsis thaliana GN=SUC6 PE=5 SV=2)

HSP 1 Score: 292.352 bits (747), Expect = 2.285e-78
Identity = 153/288 (53.12%), Postives = 185/288 (64.24%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTDSVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQRLEEIDDKETAPPT-----KDPFFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNSKGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTKLIDG 861
            +SG++VQP VG+ SD CKSRFGRRRP                 YAAD GHS GD   + VK RA++IF +GFWILD ANNTLQGP RA L DL+    KKTRTAN+FFSFFMAVGNVLGYAAGSYT+L  + PFT +KACD  CANLK+CFFLS                   L  ++DK+ +P       K PFF EIFGA K +++PMW+LL  TALNWIAW P LL DTDWM R+VY  +SKG     K+YN  +    LGLMLN+  LG  SL +  +++ + G
Sbjct:   77 VSGLLVQPSVGYFSDRCKSRFGRRRPFIAMGALLVAVAVVLIGYAADFGHSMGDKVDEPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTII--------ALWYVEDKQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGGLGLMLNSIVLGFMSLGIEGISRKMGG 356          
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUC7_ARATH (Putative sucrose transport protein SUC7 OS=Arabidopsis thaliana GN=SUC7 PE=5 SV=2)

HSP 1 Score: 288.5 bits (737), Expect = 3.299e-77
Identity = 151/288 (52.43%), Postives = 185/288 (64.24%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTDSVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQRLEEIDDKETAPPT-----KDPFFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNSKGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTKLIDG 861
            +SG++VQP VG+ SD C SRFGRRRP                 YAAD GHS GD     VK RA++IF +GFWILD ANNTLQGP RA L DL+    +KTRTAN+FFSFFMAVGNVLGYAAGSYT+L  + PFT +KACD  CANLK+CFFLS                   L  ++DK+ +P       K PFF EIFGA K +++PMW+LL  TALNWIAW P LL DTDWM R+VY  +SKG     K+YN  +   +LGLMLN+  LG+ SL +  +++ + G
Sbjct:   76 VSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVSVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAQKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTII--------ALWYVEDKQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGVMSLGIEGISRKMGG 355          
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUC1_ARATH (Sucrose transport protein SUC1 OS=Arabidopsis thaliana GN=SUC1 PE=1 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 1.254e-76
Identity = 151/293 (51.54%), Postives = 185/293 (63.14%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTDSVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQRLEEIDDKETAPPTKD----------PFFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNSKGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTKLIDG 861
            +SGMIVQPIVGFHSD C+S+FGRRRP                 YAAD G+  GD   + VK RAI IF +GFWILD ANNTLQGP RA L DL+    K+TR AN+FFSFFMAVGNVLGYAAGSYT+L  M PFT +KACD  CANLKTCFFLS                   L  ++DK+ +PP ++          P F EIFGA K +++PMW+LL  TALNWIAW P LL DTDWM R+V+  +S G     K+Y+  V++ ++GLM N+  LG  SL V  + + + G
Sbjct:   77 VSGMIVQPIVGFHSDRCRSKFGRRRPFIATGAALVAVAVFLIGYAADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTV--------TSLWYVNDKQWSPPPRNADDDEKTSSVPLFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLFDTDWMGREVFGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLGVEWIGRKLGG 361          
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUC5_ARATH (Sucrose transport protein SUC5 OS=Arabidopsis thaliana GN=SUC5 PE=1 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 2.793e-76
Identity = 153/291 (52.58%), Postives = 184/291 (63.23%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTDSVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQRLEEIDDKETAPPTKDP--------FFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNSKGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTKLIDG 861
            ISGMIVQPIVG+HSD C+SRFGRRRP                 +AAD+GHS GD   + V+TRAIIIF+ GFW LD ANNTLQGP RA L DL+    KKTR AN+ FSFFMAVGNVLGYAAGSYT+L  M PFT +KACD  CANLKTCFFLS                   L  + DK+ +PP  D         FF EIFGA++ +++PM +LL  T +NWIAW P +L DTDWM R+VY  NS G     K+Y+  V+A +LGLM N+  LG  SL V  + + + G
Sbjct:   78 ISGMIVQPIVGYHSDRCESRFGRRRPFIAAGVALVAVSVFLIGFAADMGHSFGDKLENKVRTRAIIIFLTGFWFLDVANNTLQGPCRAFLADLAAGDAKKTRVANACFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTF--------SSLWYVKDKQWSPPQGDKEEKTSSLFFFGEIFGAVRHMKRPMVMLLIVTVINWIAWFPFILYDTDWMGREVYGGNSDGDERSKKLYDQGVQAGALGLMFNSILLGFVSLGVESIGRKMGG 360          
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUT_SPIOL (Sucrose transport protein OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.447e-72
Identity = 145/292 (49.66%), Postives = 189/292 (64.73%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTDSVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQR--LEEIDDKE-------TAPPTKDPFFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNSKGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTKLIDG 861
            ISGMIVQP+VG++SD C SRFGRRRP                 +AADIG ++GD   +  K RAI +FV+GFWILD ANNTLQGP RALL D++  S  KTR AN+FFSFFMA+GN+ GYAAGSY+ L  + PFTK+ ACD  CANLK+CFF+S                E++  ++EI ++E       ++   + PFF ++ GALK + KPM ILL  TALNWIAW P LL DTDWM ++VY     GT  E K+Y+  V A +LGLM+N+  LG+ SL++  L +++ G
Sbjct:   82 ISGMIVQPLVGYYSDRCTSRFGRRRPFIAAGAALVAVAVGLIGFAADIGAASGDPTGNVAKPRAIAVFVVGFWILDVANNTLQGPCRALLADMAAGSQTKTRYANAFFSFFMALGNIGGYAAGSYSRLYTVFPFTKTAACDVYCANLKSCFFISITLLIVLTILALSVVKERQITIDEIQEEEDLKNRNNSSGCARLPFFGQLIGALKDLPKPMLILLLVTALNWIAWFPFLLFDTDWMGKEVY----GGTVGEGKLYDQGVHAGALGLMINSVVLGVMSLSIEGLARMVGG 369          
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUC4_ARATH (Sucrose transport protein SUC4 OS=Arabidopsis thaliana GN=SUC4 PE=1 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 9.341e-56
Identity = 121/281 (43.06%), Postives = 159/281 (56.58%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTDSVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQRLEEIDDKE--TAPPTKDPFFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNSKGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTK 849
            +SG+ VQP+VG  SD C S++GRRRP                 +AADIG + GD     +K RAI+ FV+GFWILD ANN  QGP RALL DL+ + N++TR AN +FS FMAVGNVLGYA GSY     +  FTK+ AC+ +CANLK+ F++                 E  L  +  +       T + F SEIFG  +     +WI+L  TAL WI W P +L DTDWM R++Y     G  +    Y+  V   +LGLMLN+  LGITS+ +  L +
Sbjct:   87 LSGLFVQPLVGHSSDRCTSKYGRRRPFIVAGAVAISISVMVIGHAADIGWAFGDR-EGKIKPRAIVAFVLGFWILDVANNMTQGPCRALLADLTENDNRRTRVANGYFSLFMAVGNVLGYATGSYNGWYKIFTFTKTVACNVECANLKSAFYIDVVFIAITTILSVSAAHEVPLASLASEAHGQTSGTDEAFLSEIFGTFRYFPGNVWIILLVTALTWIGWFPFILFDTDWMGREIY----GGEPNIGTSYSAGVSMGALGLMLNSVFLGITSVLMEKLCR 362          
BLAST of EY659407 vs. ExPASy Swiss-Prot
Match: SUT2_ORYSJ (Sucrose transport protein 2 OS=Oryza sativa subsp. japonica GN=SUT2 PE=2 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 1.543e-50
Identity = 109/283 (38.52%), Postives = 157/283 (55.48%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDT---CKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSGTD-SVKTRAIIIFVIGFWILDDANNTLQGP*RALLTDLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLDHMLPFTKSKACDADCANLKTCFFLSXXXXXXXXXXXXXXXXEQRLEEIDDKETAPPTKDPFFSEIFGALKGVQKPMWILLAETALNWIAWIPLLLLDTDWMRRDVYCRNSKGTAHELKVYNNRVRAESLGLMLNASSLGITSLAVGVLTK 849
            +SG++VQP+VG  SD      S  GRRRP                 ++AD+G   GDS T  S +  AII++++GFW+LD  NN  QGP RA L DL+ +  ++TR AN++FS FMA+GN+LGYA G+Y+    + PFT + +C   CANLK+ F L                 E +    D+ +     ++ F  E+FG+ +    P+W++L  TAL WI W P +L DTDWM R++Y R S       + Y++ VR  S GLMLN+  LG TS+ +  L +
Sbjct:   71 LSGLLVQPLVGHLSDRIAPAASPLGRRRPFIAAGAASIAAAVLTVGFSADLGRIFGDSITPGSTRLGAIIVYLVGFWLLDVGNNATQGPCRAFLADLTENDPRRTRIANAYFSLFMALGNILGYATGAYSGWYKIFPFTVTPSCSISCANLKSAFLLDIIILVVTTCITVASVQEPQSFGSDEADHPSTEQEAFLWELFGSFRYFTLPVWMVLIVTALTWIGWFPFILFDTDWMGREIY-RGSPDDPSITQSYHDGVRMGSFGLMLNSVLLGFTSIVLEKLCR 352          
The following BLAST results are available for this feature:
BLAST of EY659407 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
SUC2_ARATH2.699e-7956.01Sucrose transport protein SUC2 OS=Arabidopsis thal... [more]
SUC8_ARATH1.340e-7853.82Sucrose transport protein SUC8 OS=Arabidopsis thal... [more]
SUC9_ARATH2.285e-7853.50Sucrose transport protein SUC9 OS=Arabidopsis thal... [more]
SUC6_ARATH2.285e-7853.13Putative sucrose transport protein SUC6 OS=Arabido... [more]
SUC7_ARATH3.299e-7752.43Putative sucrose transport protein SUC7 OS=Arabido... [more]
SUC1_ARATH1.254e-7651.54Sucrose transport protein SUC1 OS=Arabidopsis thal... [more]
SUC5_ARATH2.793e-7652.58Sucrose transport protein SUC5 OS=Arabidopsis thal... [more]
SUT_SPIOL2.447e-7249.66Sucrose transport protein OS=Spinacia oleracea PE=... [more]
SUC4_ARATH9.341e-5643.06Sucrose transport protein SUC4 OS=Arabidopsis thal... [more]
SUT2_ORYSJ1.543e-5038.52Sucrose transport protein 2 OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-G09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659407 ID=EY659407|Name=EY659407|organism=Citrus sinensis|type=EST|length=865bp
CCACGCGTCCGCATCTCCGGCATGATCGTCCAGCCCATCGTCGGCTTCCA
CAGCGACACCTGCAAATCCCGCTTCGGCCGTCGCCGCCCCTTCATTCTCG
CCGGCGCCGTCCTCGTCGCCATCGCTGTGTTTCTCATCGGCTACGCCGCC
GACATAGGCCACTCCGCGGGCGACTCCGGTACCGATTCCGTCAAAACCCG
CGCCATCATCATCTTCGTCATCGGCTTCTGGATTCTCGACGATGCGAATA
ACACATTACAAGGCCCATGAAGAGCCCTCCTCACCGATCTCTCCGGCAGC
AGCAACAAGAAAACAAGAACCGCAAACTCTTTTTTCTCCTTCTTCATGGC
CGTCGGTAACGTGCTTGGCTATGCCGCCGGCTCCTACACTCACTTGGACC
ACATGCTTCCGTTCACAAAGTCAAAAGCTTGCGACGCTGACTGTGCAAAT
TTGAAAACGTGCTTCTTCCTCTCCATAGATCTGCTAATAACCCTAACGAC
AATAGCACTGATTTACGTAACTGAGCAAAGATTAGAAGAGATTGATGATA
AAGAAACGGCGCCGCCCACGAAGGATCCATTTTTCAGCGAGATATTTGGT
GCATTGAAAGGCGTGCAAAAGCCTATGTGGATCCTACTTGCGGAGACAGC
GCTGAACTGGATTGCATGGATCCCGCTCTTGCTGCTCGACACTGATTGGA
TGCGGAGGGACGTGTACTGTAGGAACTCTAAGGGCACTGCACATGAGCTG
AAGGTGTATAACAATCGGGTGAGAGCGGAGTCGTTGGGGCTGATGCTTAA
CGCTAGCAGTCTGGGGATCACGTCGCTGGCTGTGGGAGTCCTGACGAAAC
TGATAGATGGCGTCA
back to top