EY659394

Overview
NameEY659394
Unique NameEY659394
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length543
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12605 contig Csv1_Contig12605:810..1352. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDHC_MEDSA (Malate dehydrogenase, cytoplasmic OS=Medicago sativa GN=CMDH PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.723e-43
Identity = 85/105 (80.95%), Postives = 91/105 (86.67%), Query Frame = 1
Query:    7 VRGEFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEK 321
            + GEFI+TVQQRGAAIIKARK           CDHIRDWVLGTP+GT+VSMGVYSDGSYNVP+GLIYSFPVTC NGEW IVQGLSIDEFSRKKLDLTAEEL+EEK
Sbjct:  220 LNGEFISTVQQRGAAIIKARKLSSALSAASAACDHIRDWVLGTPQGTFVSMGVYSDGSYNVPSGLIYSFPVTCANGEWKIVQGLSIDEFSRKKLDLTAEELTEEK 324          
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDHC2_ARATH (Malate dehydrogenase, cytoplasmic 2 OS=Arabidopsis thaliana GN=At5g43330 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 5.013e-43
Identity = 84/105 (80.00%), Postives = 90/105 (85.71%), Query Frame = 1
Query:    7 VRGEFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEK 321
            + GEFI+TVQQRGAAIIKARK           CDHIRDWV+GTPEGT+VSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGL ID+ SRKK+DLTAEEL EEK
Sbjct:  220 LNGEFISTVQQRGAAIIKARKLSSALSAASSACDHIRDWVVGTPEGTFVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLPIDDASRKKMDLTAEELKEEK 324          
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDHC_MESCR (Malate dehydrogenase, cytoplasmic OS=Mesembryanthemum crystallinum GN=MDH PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 3.250e-42
Identity = 82/105 (78.10%), Postives = 87/105 (82.86%), Query Frame = 1
Query:    7 VRGEFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEK 321
            + GEFITTVQQRGAAIIKARK           CDHI DWVLGTPEGTWVSMGVYSDGSYNVPAG+IYSFPVTC+NGEWTIVQGL ID+ SRKK+D TA EL EEK
Sbjct:  220 LNGEFITTVQQRGAAIIKARKLSSALSAASSACDHIHDWVLGTPEGTWVSMGVYSDGSYNVPAGIIYSFPVTCKNGEWTIVQGLPIDDDSRKKMDATAAELVEEK 324          
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDHC1_ARATH (Malate dehydrogenase, cytoplasmic 1 OS=Arabidopsis thaliana GN=At1g04410 PE=1 SV=2)

HSP 1 Score: 170.244 bits (430), Expect = 5.543e-42
Identity = 82/103 (79.61%), Postives = 89/103 (86.41%), Query Frame = 1
Query:   13 GEFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEK 321
            GEFI+TVQQRGAAIIKARK           CDHIRDWVLGTPEGT+VSMGVYSDGSY+VP+GLIYSFPVTCRNG+W+IVQGL IDE SRKK+DLTAEEL EEK
Sbjct:  222 GEFISTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEELKEEK 324          
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDHC_BETVU (Malate dehydrogenase, cytoplasmic OS=Beta vulgaris GN=NR1 PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.235e-41
Identity = 81/106 (76.42%), Postives = 87/106 (82.08%), Query Frame = 1
Query:    7 VRGEFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEKA 324
            + GEFITTVQQRGAAIIKARK           CDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAG+IYSFPVTC++GEW IVQGL IDE SR+K+D T  EL EEKA
Sbjct:  220 LNGEFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGIIYSFPVTCKDGEWKIVQGLPIDEVSRQKMDATGAELVEEKA 325          
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDHC_ORYSJ (Malate dehydrogenase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os10g0478200 PE=1 SV=3)

HSP 1 Score: 167.933 bits (424), Expect = 2.751e-41
Identity = 82/102 (80.39%), Postives = 86/102 (84.31%), Query Frame = 1
Query:   16 EFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEK 321
            EFI+TVQQRGAAIIKARK           CDHIRDWVLGTPEGT+VSMGVYSDGSY VPAGLIYSFPVTC  GEWTIVQGL IDEFSRKK+D TA+ELSEEK
Sbjct:  223 EFISTVQQRGAAIIKARKQSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYGVPAGLIYSFPVTCSGGEWTIVQGLPIDEFSRKKMDATAQELSEEK 324          
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDHC_MAIZE (Malate dehydrogenase, cytoplasmic OS=Zea mays PE=2 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 3.593e-41
Identity = 81/105 (77.14%), Postives = 87/105 (82.86%), Query Frame = 1
Query:    7 VRGEFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEK 321
            + GEFITTVQQRGAAIIKARK           CDHIRDWVLGTPEGT+VSMGVYSDGSY VP+GLIYSFPVTC  GEW IVQGL IDEFSRKK+D TA+EL+EEK
Sbjct:  220 LNGEFITTVQQRGAAIIKARKFSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYGVPSGLIYSFPVTCSGGEWKIVQGLPIDEFSRKKMDATAQELTEEK 324          
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDH_HALHL (Malate dehydrogenase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=mdh PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.371e-31
Identity = 65/105 (61.90%), Postives = 76/105 (72.38%), Query Frame = 1
Query:    7 VRGEFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEK 321
            V+  FI TVQQRGAAIIKAR             DH+RDW LGTPEG W SM V SDGSY + AGLIYSFPVTCR G++ IV GLS+D+FSR ++D TA EL+EE+
Sbjct:  214 VKDTFIPTVQQRGAAIIKARGASSAASAASAAIDHMRDWALGTPEGEWTSMAVPSDGSYGIEAGLIYSFPVTCRGGDYKIVSGLSVDDFSRARMDQTAAELAEER 318          
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDH_ALCBS (Malate dehydrogenase OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=mdh PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 4.402e-31
Identity = 61/102 (59.80%), Postives = 75/102 (73.53%), Query Frame = 1
Query:   16 EFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEK 321
            ++I TVQQRGAAIIKAR             DH+R W LGT EG WVSMG+YSDGSY +  GLIYSFP TC+NG+WTIVQGL +++FSR K+  T +EL+EE+
Sbjct:  219 DYIPTVQQRGAAIIKARGASSAASAANAAVDHMRSWALGTDEGDWVSMGIYSDGSYGIQEGLIYSFPCTCKNGDWTIVQGLEVNDFSRGKMQATEQELAEER 320          
BLAST of EY659394 vs. ExPASy Swiss-Prot
Match: MDH_SACD2 (Malate dehydrogenase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mdh PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 5.749e-31
Identity = 64/102 (62.75%), Postives = 72/102 (70.59%), Query Frame = 1
Query:   16 EFITTVQQRGAAIIKARKXXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCRNGEWTIVQGLSIDEFSRKKLDLTAEELSEEK 321
            +FI TVQQRGAAIIKAR              H+RDW LGTPE  WVSMGVYSDGSY +  GLIYSFP  C+NG+W IVQGL+IDEFSR K+  T  EL EE+
Sbjct:  217 DFIPTVQQRGAAIIKARGASSAASAANAAIFHMRDWALGTPENDWVSMGVYSDGSYGIEEGLIYSFPCVCKNGDWEIVQGLTIDEFSRAKMTATENELKEER 318          
The following BLAST results are available for this feature:
BLAST of EY659394 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 169
Match NameE-valueIdentityDescription
MDHC_MEDSA1.723e-4380.95Malate dehydrogenase, cytoplasmic OS=Medicago sati... [more]
MDHC2_ARATH5.013e-4380.00Malate dehydrogenase, cytoplasmic 2 OS=Arabidopsis... [more]
MDHC_MESCR3.250e-4278.10Malate dehydrogenase, cytoplasmic OS=Mesembryanthe... [more]
MDHC1_ARATH5.543e-4279.61Malate dehydrogenase, cytoplasmic 1 OS=Arabidopsis... [more]
MDHC_BETVU1.235e-4176.42Malate dehydrogenase, cytoplasmic OS=Beta vulgaris... [more]
MDHC_ORYSJ2.751e-4180.39Malate dehydrogenase, cytoplasmic OS=Oryza sativa ... [more]
MDHC_MAIZE3.593e-4177.14Malate dehydrogenase, cytoplasmic OS=Zea mays PE=2... [more]
MDH_HALHL3.371e-3161.90Malate dehydrogenase OS=Halorhodospira halophila (... [more]
MDH_ALCBS4.402e-3159.80Malate dehydrogenase OS=Alcanivorax borkumensis (s... [more]
MDH_SACD25.749e-3162.75Malate dehydrogenase OS=Saccharophagus degradans (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-F08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659394 ID=EY659394|Name=EY659394|organism=Citrus sinensis|type=EST|length=543bp
CCACGCGTCCGTGGAGAATTCATAACCACAGTCCAACAACGTGGTGCTGC
AATCATCAAAGCCAGAAAGCTCTCGAGTGCTCTGTCTGCTGCTAGCTCTG
CTTGTGACCATATCCGTGATTGGGTTCTTGGAACTCCTGAGGGCACCTGG
GTCTCCATGGGGGTATACTCTGATGGTTCATACAATGTACCAGCTGGGCT
CATTTACTCATTCCCAGTAACCTGCCGCAACGGTGAATGGACAATTGTTC
AAGGACTCAGCATTGATGAATTCTCAAGGAAGAAGTTGGACTTGACAGCA
GAGGAGCTCTCCGAGGAGAAGGCCCTCGCATACTCATGTCTCTCTTAAAT
GCTTTCTTCCCTTCAATAGTGTGTTACCAAGGCCCTTAGCTTTGTCTGAG
TAGTTGGTATAGTTACAGTTTCGAATAAAACCATTGTTGAAACCTGGAGG
AACCATTGATGATGGAGAAGGCTTTCCATCTTATGTTGCTATTTCTGCAT
TTGAATATCGGGATTTTGGAGTTTTGTCTTCCCCGGGGAATAA
back to top