EY659390

Overview
NameEY659390
Unique NameEY659390
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: MTDH_MEDSA (Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 5.392e-66
Identity = 114/209 (54.55%), Postives = 144/209 (68.90%), Query Frame = 2
Query:   53 MAKSPEEEHPVKAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFGAK 679
            MAKSPE E P+KAFGWAARD+SG LSPF+FSRRE GD+DV +K+LYCG+CH+DLH +KN+WGF+ +P+VPGHEI G VT+                     +C +CE+C  DLE YCPK + TY S    GT TYGGYSD +V ++RY+V+FPD++PLDA APLLCAGITVYSP+KY+ + E                A+KF +AFG K
Sbjct:    1 MAKSPETELPLKAFGWAARDTSGTLSPFHFSRRENGDDDVSVKILYCGVCHSDLHTLKNDWGFTTYPVVPGHEIVGVVTKVGINVKKFRVGDNVGVGVIVESCQTCENCNQDLEQYCPKPVFTYNS-PYKGTRTYGGYSDFVVVHQRYVVQFPDNLPLDAGAPLLCAGITVYSPMKYYGMTEPGKHLGVAGLGGLGHVAIKFGKAFGLK 208          

HSP 2 Score: 28.8758 bits (63), Expect = 5.392e-66
Identity = 22/60 (36.67%), Postives = 31/60 (51.67%), Query Frame = 3
Query:  705 QKTEALETSGADSFLNSVTPDXCR-VHGHIDGLLTQCPLCTPF--ALGXL*SPGKLVLVG 875
            ++TEA++  GADSFL S  P+  +   G +D ++            LG L   GKLV VG
Sbjct:  218 KETEAIDKLGADSFLVSKDPEKMKAAMGTMDYIIDTISAAHSLMPLLGLLKLNGKLVTVG 277          
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: MTDH_APIGR (Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 2.651e-65
Identity = 114/209 (54.55%), Postives = 142/209 (67.94%), Query Frame = 2
Query:   53 MAKSPEEEHPVKAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFGAK 679
            MAKS E EHPVKAFGWAARD++G LSPF FSRR TG++DVRLKVL+CG+CH+D H I N WGF+ +P+VPGHEI G VTE                     +C SCESC ++ E++C   I TY SI  DGT+T+GGYSD MVA+E +I+R+P ++PLD+ APLLCAGIT YSPLKY+ L +                AVK A+AFGA+
Sbjct:    1 MAKSSEIEHPVKAFGWAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPGHEIVGVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTMTHGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGLDKPGTKIGVVGLGGLGHVAVKMAKAFGAQ 209          

HSP 2 Score: 34.2686 bits (77), Expect = 2.651e-65
Identity = 26/61 (42.62%), Postives = 34/61 (55.74%), Query Frame = 3
Query:  705 QKTEALETSGADSF-LNSVTPDXCRVHGHIDGLLTQCPLCTPFA-LGXL*SP-GKLVLVGS 878
            ++ EALE  GADSF LNS           +DG++   P+  P A L  L  P GKLV+VG+
Sbjct:  219 KRKEALEKLGADSFLLNSDQEQMKGARSSLDGIIDTVPVNHPLAPLFDLLKPNGKLVMVGA 279          
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: MTDH_MESCR (Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 5.172e-65
Identity = 133/257 (51.75%), Postives = 158/257 (61.48%), Query Frame = 2
Query:   62 SPEEEHPVKAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFGAK*Q*LAPL-XAED*SS*NIWR*FIFE*RDP*XLQGAWAH-*WIIDTVSAVHP 826
            +PE  HP KAFGWAARD+SG LSP  FSRR TG++DV  KVLYCGICH+DLH IKNEWG +++P +PGHEI G VTE                     +C SCESC N LENYCPK+I TY S   DGT+TYGGYSD MV  E + VR PD+M LDA APLLCAG+TVYSPLK+FEL +                AVKF +AFGAK   ++     +D +   +        R+P  +Q A      IIDTVSA HP
Sbjct:    5 APENVHPQKAFGWAARDTSGTLSPLKFSRRATGEQDVTFKVLYCGICHSDLHYIKNEWGNAVYPAIPGHEIVGVVTEVGNKVQNFKVGDKVGVGCMVGSCRSCESCENHLENYCPKMILTYGSTYYDGTLTYGGYSDIMVVEEHFAVRIPDNMALDATAPLLCAGVTVYSPLKHFELDKPGLHIGVVGLGGLGHMAVKFGKAFGAKVTVISTSPNKKDEAVNRLGADSFVVSREPEQMQSAMGTLDGIIDTVSAAHP 261          
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: MTDH_FRAAN (Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 5.718e-64
Identity = 133/255 (52.16%), Postives = 159/255 (62.35%), Query Frame = 2
Query:   68 EEEHPVKAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFGAK*Q*LAPL-XAED*SS*NIWR*FIFE*RDP*XLQGA-WAH*WIIDTVSAVHP 826
            E+EH  KA GWAARDSSG LSPFNF RRETG++DV  KVLYCGICH+DLH +KNEWGFS +P+VPGHEI GEVTE                     +C SCE+C + LENYCPK I TY +   DG+ TYGGYSD MVA+E +IVR PD++PLD AAPLLCAGIT YSPL+YF L +                AVKFA+A G K   ++     E+ +  ++        RD   +Q A      IIDTVSA HP
Sbjct:    4 EQEHRKKASGWAARDSSGVLSPFNFYRRETGEKDVTFKVLYCGICHSDLHMVKNEWGFSTYPLVPGHEIVGEVTEVGSKVQKFKVGDRVGVGCIVGSCRSCENCTDHLENYCPKQILTYGAKYYDGSTTYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGLDKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKEEEALKHLGADSFLVSRDQDQMQAAIGTMDGIIDTVSAQHP 258          
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: GEDH1_OCIBA (Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.274e-63
Identity = 131/260 (50.38%), Postives = 161/260 (61.92%), Query Frame = 2
Query:   53 MAKSPEEEHPVKAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFGAK*Q*LA-PLXAED*SS*NIWR*FIFE*RDP*XLQGA-WAH*WIIDTVSAVHP 826
            MAKSPE EHPVKA GWAA D+SG  SPFNFSRR TG+ DV+ +VLYCG+CH+DLH +KNEWG + +P+VPGHEI G VTE                     +C  C+ C+NDLENYC K I TY +   DGTI  GGYSD MVA+E +I+R+P++ PLDA APLLCAGIT YSPLKYF L +                AVKFA+AFG K   ++  L  ++ +  ++         DP  +Q A      IIDTVSA HP
Sbjct:    1 MAKSPETEHPVKALGWAATDNSGTFSPFNFSRRATGERDVQFRVLYCGVCHSDLHMVKNEWGVTHYPIVPGHEIVGIVTEVGSKVEKVKIGDKVGVGVLVGSCRQCDQCSNDLENYCYKQILTYGAPYLDGTIARGGYSDIMVADEHFIIRWPENFPLDAGAPLLCAGITTYSPLKYFGLDKPGLRVGVNGLGGLGHVAVKFAKAFGTKVTVISTSLSKKEEAMQHLGVDEFVVSTDPQQMQAAVGTLDGIIDTVSAPHP 260          
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: CADH9_ARATH (Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=1 SV=2)

HSP 1 Score: 240.736 bits (613), Expect = 8.256e-63
Identity = 120/259 (46.33%), Postives = 161/259 (62.16%), Query Frame = 2
Query:   53 MAKSPEEEHPVKAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFGAK*Q*LAPLXAED*SS*N-IWR*FIFE*RDP*XLQGA-WAH*WIIDTVSAVH 823
            MAKSPE EHP K FGW ARD SG LSPF+FSRR+ G+ DV +K+L+CG+CHTDLH IKN+WG+S +P+VPGHEI G  T+                     +C SCESC  DLENYCP++  TY +I +DGT  YGGYS+ +V ++R+++RFP+++P D+ APLLCAGITVYSP+KY+ + E                AVK  +AFG K   ++    +   + N +         DP  ++ A     +IIDT+SAVH
Sbjct:    1 MAKSPETEHPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPVVPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIGSDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMTEAGKHLGVAGLGGLGHVAVKIGKAFGLKVTVISSSSTKAEEAINHLGADSFLVTTDPQKMKAAIGTMDYIIDTISAVH 259          
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: CADH5_ORYSJ (Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CAD5 PE=3 SV=2)

HSP 1 Score: 228.024 bits (580), Expect = 1.548e-62
Identity = 109/198 (55.05%), Postives = 132/198 (66.67%), Query Frame = 2
Query:   80 PVKAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFG 673
            P  A G AARD+SGHLSP   SRR TGD+DV +K+LYCGICH+DLH+IKNEW  + +P+VPGHEIAG VTE                     +CHSC+SC   LEN+CP VI TY S++ DGT+TYGGYS  +V +ER++VRFP++MPLD  APLLCAGITVYSP+KY  L                  AVKFA+AFG
Sbjct:    3 PTAAAGLAARDASGHLSPLTISRRSTGDDDVVIKILYCGICHSDLHSIKNEWKNATYPLVPGHEIAGVVTEAGKNVTKFKGGDKVGVGCMVNSCHSCDSCNQGLENHCPGVIFTYNSVDKDGTVTYGGYSSMVVVHERFVVRFPEAMPLDKGAPLLCAGITVYSPMKYHGLNVPSKHVGVLGLGGLGHVAVKFAKAFG 200          

HSP 2 Score: 33.8834 bits (76), Expect = 1.548e-62
Identity = 23/60 (38.33%), Postives = 32/60 (53.33%), Query Frame = 3
Query:  705 QKTEALETSGADSFLNSVTPDXCR-VHGHIDGLLTQCPLCTPFA--LGXL*SPGKLVLVG 875
            ++ EALE  GAD+F+ S   D      G +DG++       P A  LG L   GK++LVG
Sbjct:  212 KRQEALERLGADAFVVSKNADEMNAATGTMDGIINTVSANIPIAPLLGLLKPNGKMILVG 271          
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: CADH6_ARATH (Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.192e-61
Identity = 112/206 (54.37%), Postives = 139/206 (67.48%), Query Frame = 2
Query:   62 SPEEEHPVKAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFGAK 679
            S E+E  V+AFGWAARDSSGHLSPF FSRR+TG+E+VR+KVLYCGICH+DLH +KNEW  S++P+VPGHEI GEV+E                     +C +CESC  D ENYC K I TY  ++ DGTI YGGYSD +V +ERY V+ P ++PL +AAPLLCAGI++YSP+KYF L                   V+FA+AFG K
Sbjct:    5 SGEKEQSVEAFGWAARDSSGHLSPFVFSRRKTGEEEVRVKVLYCGICHSDLHCLKNEWHSSIYPLVPGHEIIGEVSEIGNKVSKFNLGDKVGVGCIVDSCRTCESCREDQENYCTKAIATYNGVHHDGTINYGGYSDHIVVDERYAVKIPHTLPLVSAAPLLCAGISMYSPMKYFGLTGPDKHVGIVGLGGLGHIGVRFAKAFGTK 210          
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: CADH3_ORYSJ (Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.293e-61
Identity = 108/198 (54.55%), Postives = 132/198 (66.67%), Query Frame = 2
Query:   86 KAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFGAK 679
            +A G AARDSSGHLSPF  SRR TGD+DV +K+L+CGICH+DLH IKNEW  S++P+VPGHEIAG VTE                     +C SCESC N  EN+CP+ + TY S++ DGT+TYGGYS  +V +ER++V FP++MPLD  APLLCAGITVY+P+KY  L                  AVKFARAFG K
Sbjct:   15 QAVGLAARDSSGHLSPFAISRRSTGDDDVAIKILFCGICHSDLHCIKNEWKHSIYPLVPGHEIAGVVTEVGKNVTRFKAGDRVGVGCMVNSCRSCESCNNGFENHCPEGVFTYNSVDKDGTVTYGGYSSMVVVHERFVVMFPEAMPLDVGAPLLCAGITVYTPMKYHGLNAPGKHVGVLGLGGLGHVAVKFARAFGLK 212          

HSP 2 Score: 31.9574 bits (71), Expect = 1.293e-61
Identity = 22/60 (36.67%), Postives = 32/60 (53.33%), Query Frame = 3
Query:  705 QKTEALETSGADSFLNSVTPDXCR-VHGHIDGLLTQCPLCTPFA--LGXL*SPGKLVLVG 875
            +K EALE  GAD+F+ S + +        +DG++      TP A  L  L   GK++LVG
Sbjct:  222 KKREALERLGADAFVVSSSAEEMEAARSTMDGVINTVSANTPMAPYLALLKPNGKMILVG 281          
BLAST of EY659390 vs. ExPASy Swiss-Prot
Match: CADH8_ARATH (Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 3.700e-58
Identity = 107/198 (54.04%), Postives = 130/198 (65.66%), Query Frame = 2
Query:   86 KAFGWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKVIPTYTSINTDGTITYGGYSDQMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFELAEXXXXXXXXXXXXXXXXAVKFARAFGAK 679
            +AFG AA+D+SG LSPF+F+RRETG++DVR KVL+CGICH+DLH +KNEWG S +P+VPGHEI G VTE                     +C SC+SC   +ENYCPK I TY     D TITYGGYSD MV  E +++R PD++PLDAAAPLLCAGITVYSP+KY  L +                 VKFA+A G K
Sbjct:    8 EAFGLAAKDNSGVLSPFSFTRRETGEKDVRFKVLFCGICHSDLHMVKNEWGMSTYPLVPGHEIVGVVTEVGAKVTKFKTGEKVGVGCLVSSCGSCDSCTEGMENYCPKSIQTYGFPYYDNTITYGGYSDHMVCEEGFVIRIPDNLPLDAAAPLLCAGITVYSPMKYHGLDKPGMHIGVVGLGGLGHVGVKFAKAMGTK 205          

HSP 2 Score: 24.2534 bits (51), Expect = 3.700e-58
Identity = 16/40 (40.00%), Postives = 22/40 (55.00%), Query Frame = 1
Query:  676 KVTVISTSPSRRLKLLKHLALIHF*IA-*PLTIAGCMGTL 792
            KVTVISTS  +R + +  L    F ++  P  I   MGT+
Sbjct:  205 KVTVISTSEKKRDEAINRLGADAFLVSRDPKQIKDAMGTM 244          
The following BLAST results are available for this feature:
BLAST of EY659390 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 81
Match NameE-valueIdentityDescription
MTDH_MEDSA5.392e-6654.55Probable mannitol dehydrogenase OS=Medicago sativa... [more]
MTDH_APIGR2.651e-6554.55Mannitol dehydrogenase OS=Apium graveolens GN=MTD ... [more]
MTDH_MESCR5.172e-6551.75Probable mannitol dehydrogenase OS=Mesembryanthemu... [more]
MTDH_FRAAN5.718e-6452.16Probable mannitol dehydrogenase OS=Fragaria ananas... [more]
GEDH1_OCIBA1.274e-6350.38Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GE... [more]
CADH9_ARATH8.256e-6346.33Probable cinnamyl alcohol dehydrogenase 9 OS=Arabi... [more]
CADH5_ORYSJ1.548e-6255.05Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza... [more]
CADH6_ARATH1.192e-6154.37Probable cinnamyl alcohol dehydrogenase 6 OS=Arabi... [more]
CADH3_ORYSJ1.293e-6154.55Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza... [more]
CADH8_ARATH3.700e-5854.04Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-F04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659390 ID=EY659390|Name=EY659390|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGAACCAATACAATAATGATAACATTGCCGTTCTCTCATCA
AAATGGCAAAATCACCAGAAGAAGAACATCCAGTAAAGGCCTTTGGGTGG
GCAGCCCGAGACAGCTCCGGCCATCTCTCCCCATTCAACTTCTCCAGAAG
GGAAACGGGTGATGAGGATGTGAGGCTGAAGGTATTGTATTGTGGGATCT
GCCATACTGATCTCCACAACATCAAGAATGAATGGGGCTTCTCTCTCTTC
CCTATGGTTCCTGGGCATGAAATTGCAGGGGAAGTGACAGAAGTTGGCAG
CAAAGTAAGAAAGGTTAAAGTGGGAGATAAAGTTGGAGTTGGATGCATGG
TTGGTGCATGCCACAGCTGCGAGAGCTGTGCCAATGACCTTGAAAATTAC
TGTCCGAAAGTGATACCCACCTACACTTCCATTAACACTGACGGAACAAT
CACATACGGAGGCTACTCTGATCAAATGGTTGCCAATGAGCGCTACATTG
TTCGATTCCCTGATAGCATGCCCCTTGATGCTGCTGCTCCCCTGCTTTGC
GCCGGGATTACCGTGTACAGTCCATTGAAATACTTTGAACTAGCAGAACA
TGGAAAGCATGTAGGCATCGTTGGGCTTGGTGGGCTTGGTCATGTCGCTG
TCAAATTTGCCAGGGCTTTTGGGGCAAAGTGACAGTAATTAGCACCTCTC
CNAGCAGAAGACTGAAGCTCTTGAAACATCTGGCGCTGATTCATTTTTGA
ATAGCGTGACCCCTGACNATTGCAGGGTGCATGGGCACATTGATGGATTA
TTGACACAGTGTCCGCTGTGCACCCCTTTTGCATTGGGCNGNCTTTAAAG
CCCAGGCAAGCTTGTTCTGGTGGGGTCCCACAAGCCACT
back to top