EY659386
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY659386 vs. ExPASy Swiss-Prot
Match: CRD1_GOSHI (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Gossypium hirsutum GN=CRD1 PE=2 SV=2) HSP 1 Score: 73.1738 bits (178), Expect = 2.497e-12 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 3 Query: 435 VYVTMYLNDCQRTAFYEGIGLDTKEFDMHVIIEVS 539 VYVTMYLNDCQRTAFYEGIGLDTKEFDMHVIIE + Sbjct: 286 VYVTMYLNDCQRTAFYEGIGLDTKEFDMHVIIETN 320
BLAST of EY659386 vs. ExPASy Swiss-Prot
Match: CRD1_EUPES (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Euphorbia esula GN=CRD1 PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 2.497e-12 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 3 Query: 435 VYVTMYLNDCQRTAFYEGIGLDTKEFDMHVIIEVS 539 VYVTMYLNDCQRTAFYEGIGLDTKEFDMHVIIE + Sbjct: 286 VYVTMYLNDCQRTAFYEGIGLDTKEFDMHVIIETN 320
BLAST of EY659386 vs. ExPASy Swiss-Prot
Match: CRD1_ARATH (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Arabidopsis thaliana GN=CRD1 PE=2 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 4.710e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 3 Query: 435 VYVTMYLNDCQRTAFYEGIGLDTKEFDMHVIIEVS 539 VYVTMYLNDCQRT FYEGIGL+TKEFDMHVIIE + Sbjct: 290 VYVTMYLNDCQRTNFYEGIGLNTKEFDMHVIIETN 324 The following BLAST results are available for this feature:
BLAST of EY659386 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY659386 ID=EY659386; Name=EY659386; organism=Citrus sinensis; type=EST; length=949bpback to top |