EY659312

Overview
NameEY659312
Unique NameEY659312
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length991
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659312_ssr167 microsatellite EY659312_ssr167:167..178. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: AMT31_ORYSJ (Ammonium transporter 3 member 1 OS=Oryza sativa subsp. japonica GN=AMT3-1 PE=2 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 4.962e-83
Identity = 161/238 (67.65%), Postives = 176/238 (73.95%), Query Frame = 2
Query:  227 AVPDWLNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGS-----VETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGFXCFTGGVMDYXRXXXXXXXXXXXXXXXXVTGW-GPKSTKDRKRFSP-ITYYDATRAGVAW 919
            AVP+WLNKGDNAWQMISATLVG+QSVPGLVILYGSIVKKKWAVNSAFMALYAFAAV +CW TW Y MSFG KLLPFWGKA PALGQ FL+ Q+ LP+TTQF+  G      VET  V P YPMA+MV+FQCVFAAITL++LAGS+LGRMNIKA M FVPLWL  SYTVGAF LWGGGF  F  GVMDY                     W GP+STKDR+RF P       T AG+ W
Sbjct:   18 AVPEWLNKGDNAWQMISATLVGMQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVWLCWVTWGYNMSFGHKLLPFWGKARPALGQSFLLAQAVLPQTTQFYKGGGGADAVVETPWVNPLYPMATMVYFQCVFAAITLILLAGSLLGRMNIKAWMLFVPLWLTFSYTVGAFSLWGGGF-LFHWGVMDY--SGGYVIHLSSGVAGFTAAYWVGPRSTKDRERFPPNNVLLMLTGAGILW 252          
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: AMT32_ORYSJ (Ammonium transporter 3 member 2 OS=Oryza sativa subsp. japonica GN=AMT3-2 PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.351e-80
Identity = 151/240 (62.92%), Postives = 177/240 (73.75%), Query Frame = 2
Query:  206 YQGGTSAAVPDWLNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGFXCFTGGVMDYXRXXXXXXXXXXXXXXXXVTGW-GPKSTKDRKRFSPIT-YYDATRAGVAW 919
            YQG TSA+V DWLNKGDNAWQ+++AT+VGLQSVPGLV+LYG +VKKKWAVNSAFMALYAFAAV ICW TWAY MSFG+KLLP WGKA PAL Q  L+ ++ALP T  +  DGSVETA V P YPMA++V+FQCVFAAITL+++AGS+LGRM+  A M FVPLWL  SYTVGAF LWGGGF  F  GV+DY                     W GP++ KDR+RF P    +  T AG+ W
Sbjct:   12 YQGNTSASVADWLNKGDNAWQLVAATVVGLQSVPGLVVLYGGVVKKKWAVNSAFMALYAFAAVWICWVTWAYNMSFGEKLLPIWGKARPALDQGLLVGRAALPATVHYRADGSVETAAVEPLYPMATVVYFQCVFAAITLILVAGSLLGRMSFLAWMIFVPLWLTFSYTVGAFSLWGGGF-LFHWGVIDY--CGGYVIHVSAGIAGFTAAYWVGPRAQKDRERFPPNNILFTLTGAGLLW 248          
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: AMT33_ORYSJ (Ammonium transporter 3 member 3 OS=Oryza sativa subsp. japonica GN=AMT3-3 PE=2 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 2.385e-77
Identity = 145/222 (65.32%), Postives = 166/222 (74.77%), Query Frame = 2
Query:  218 TSAAVPDWLNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGFXCFTGGVMDYXRXXXXXXXXXXXXXXXXVTGW-GPKSTKDRKRFSP 880
            T+ + PDWLNKGDNAWQM SATLVGLQS+PGLVILYGSIVKKKWA+NSAFMALYAFAAV ICW  WAY MSFGD+LLPFWGKA PALGQ FL+ QS L  T   + +GS E  M+ P YP+A+MV+FQC+FA+IT++ILAGS+LGRMNIKA MAFVPLW+  SYTV AF LWGGGF  F  GV+DY                     W GP+S  DR+RF P
Sbjct:   12 TTPSSPDWLNKGDNAWQMTSATLVGLQSMPGLVILYGSIVKKKWAINSAFMALYAFAAVWICWVVWAYNMSFGDRLLPFWGKARPALGQSFLVAQSELTATAIRYHNGSAEAPMLKPLYPVATMVYFQCMFASITIIILAGSLLGRMNIKAWMAFVPLWITFSYTVCAFSLWGGGF-LFQWGVIDY--SGGYVIHLSSGIAGLTAAYWVGPRSASDRERFPP 230          
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: AMT22_ORYSJ (Ammonium transporter 2 member 2 OS=Oryza sativa subsp. japonica GN=AMT2-2 PE=2 SV=2)

HSP 1 Score: 258.07 bits (658), Expect = 5.889e-68
Identity = 127/219 (57.99%), Postives = 158/219 (72.15%), Query Frame = 2
Query:  227 AVPDWLNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGFXCFTGGVMDYXRXXXXXXXXXXXXXXXXVTGW-GPKSTKDRKRFSP 880
            AVP WLNKGD AWQ+++AT VG+QS+PGLV++YGSIVKKKWAVNSAFMALYA+A+ +I W    ++M+FGD+LLPFW KAGPAL Q FL++++  P T  +  DG++ET    PFY  A++V F+  FAAITLV+LAGS+LGRMNIKA MAF PLWL+ SYTVGAF LWGGGF  +  GV+DY                     W GP+   DR+RFSP
Sbjct:   20 AVPAWLNKGDTAWQLVAATFVGIQSMPGLVVIYGSIVKKKWAVNSAFMALYAYASTLIVWVLVGFRMAFGDRLLPFWAKAGPALTQDFLVQRAVFPATAHYGSDGTLETPRTEPFYAEAALVLFEFEFAAITLVLLAGSLLGRMNIKAWMAFTPLWLLFSYTVGAFSLWGGGF-LYQWGVIDY--SGGYVIHLSSGVAGFTAAYWVGPRLKSDRERFSP 235          
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: AMT23_ORYSJ (Ammonium transporter 2 member 3 OS=Oryza sativa subsp. japonica GN=AMT2-3 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 6.511e-67
Identity = 128/219 (58.45%), Postives = 157/219 (71.69%), Query Frame = 2
Query:  227 AVPDWLNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGFXCFTGGVMDYXRXXXXXXXXXXXXXXXXVTGW-GPKSTKDRKRFSP 880
            AVP+WLN GDN WQ+ +AT VGLQS+PGLV+LYGSIVKKKWAVNSAFMALYA+A+ +I W    ++M+FGD+LLPFWGKAG AL + FL+ ++++P T  +  DG++E+    PFYP ASMV FQ   AAITLV+LAGS+LGRMNIKA MAF PLWL+ SYTV AF LWGGGF  +  GV+DY                     W GP+   DR+RFSP
Sbjct:   16 AVPEWLNTGDNGWQLAAATFVGLQSMPGLVVLYGSIVKKKWAVNSAFMALYAYASTLIVWVLVGFRMAFGDRLLPFWGKAGAALTEGFLVARASVPATAHYGKDGALESPRTEPFYPEASMVLFQFELAAITLVLLAGSLLGRMNIKAWMAFTPLWLLFSYTVCAFSLWGGGF-LYQWGVIDY--SGGYVIHLSSGIAGFTAAYWVGPRLKSDRERFSP 231          
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: AMT2_ARATH (Ammonium transporter 2 OS=Arabidopsis thaliana GN=AMT2 PE=1 SV=2)

HSP 1 Score: 249.98 bits (637), Expect = 1.604e-65
Identity = 126/218 (57.80%), Postives = 154/218 (70.64%), Query Frame = 2
Query:  230 VPDWLNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGFXCFTGGVMDYXRXXXXXXXXXXXXXXXXVTGW-GPKSTKDRKRFSP 880
            VP+WLNKGDNAWQ+ +ATLVGLQS+PGLVILY SIVKKKWAVNSAFMALYAFAAV++CW    YKM+FG++LLPFWGK GPA  Q +L  Q+ +P +            +  P++PMA++V+FQ  FAAIT +++AGSVLGRMNIKA MAFVPLWLI SYTVGA+ +WGGGF  +  GV+DY                     W GP+   DR+RF P
Sbjct:   12 VPEWLNKGDNAWQLTAATLVGLQSMPGLVILYASIVKKKWAVNSAFMALYAFAAVLLCWVLLCYKMAFGEELLPFWGKGGPAFDQGYLKGQAKIPNSN-----------VAAPYFPMATLVYFQFTFAAITTILVAGSVLGRMNIKAWMAFVPLWLIFSYTVGAYSIWGGGF-LYQWGVIDY--SGGYVIHLSSGVAGFVAAYWVGPRPKADRERFPP 215          
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: AMT21_ORYSJ (Ammonium transporter 2 member 1 OS=Oryza sativa subsp. japonica GN=AMT2-1 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.094e-65
Identity = 129/219 (58.90%), Postives = 158/219 (72.15%), Query Frame = 2
Query:  227 AVPDWLNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGFXCFTGGVMDYXRXXXXXXXXXXXXXXXXVTGW-GPKSTKDRKRFSP 880
            AVPDWLNKGDNAWQ+ ++TLVG+QS+PGLV+LYGSIVKKKWAVNSAFMALYA+A+ ++ W    ++M+FGD+LLPFWGKAG AL Q +L+ ++ LP T      G++      PFYP A++V FQ  FAAITLV+LAGSVLGRMNIKA MAF PLWL++SYTVGAF LWGGGF  +  GV+DY                     W GP+   DR+RFSP
Sbjct:   13 AVPDWLNKGDNAWQLTASTLVGIQSMPGLVVLYGSIVKKKWAVNSAFMALYAYASSLLVWVLVGFRMAFGDQLLPFWGKAGVALTQSYLVGRATLPATAH----GAIPRTE--PFYPEATLVLFQFEFAAITLVLLAGSVLGRMNIKAWMAFTPLWLLLSYTVGAFSLWGGGF-LYRWGVIDY--SGGYVIHLSSGIAGFTAAYWVGPRLKSDRERFSP 222          
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: Y663_METTH (Putative ammonium transporter MTH_663 OS=Methanobacterium thermoautotrophicum GN=MTH_663 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.060e-24
Identity = 59/175 (33.71%), Postives = 90/175 (51.43%), Query Frame = 2
Query:  242 LNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGFXCFTGGV 766
            LN GD AW ++S  LV L +VPG+ + YG + KK+  +N+ F++L AFA   I W  + Y+ +FG  ++ F G                 P     +  G    A + P  P    + FQ  FAAIT+ +++G+V+ RM   A +AF+ LW+ + Y   A  +WGGGF    G +
Sbjct:   10 LNSGDTAWMLVSTALVMLMTVPGVALFYGGLTKKENVLNTMFLSLIAFAVTSIIWVLYGYQFAFGADIMGFIGS----------------PVNLLMNGVGVNTAAALAPTIPDFLYIAFQLTFAAITVALISGAVVERMKFSAWLAFIVLWVSLVYVPVAHWVWGGGFLAQLGAL 168          
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: AMT_AQUAE (Ammonia channel OS=Aquifex aeolicus GN=amt PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.509e-18
Identity = 55/178 (30.90%), Postives = 85/178 (47.75%), Query Frame = 2
Query:  242 LNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGFXCFTGGVMDY 775
            L+ G+ AW ++++ LV   +VPGL + YG + K K  +N+  M+  AFA V + W    Y +++GD +  F G     +  K +   S +   T                YP    + FQ  FA IT  +++GS +GRM   A + F  LW +  Y   A  +WGGGF     G +D+
Sbjct:   25 LDTGNTAWMLVASALVVFMTVPGLALFYGGLDKSKSILNTIAMSFSAFAVVTLTWIFVGYSVAYGDDIFGFIGNPFQYVLGKGI---SGINSDTG---------------YPALLDLMFQLTFATITTALISGSFVGRMKFSAWILFAILWSVFVYPPVAHWVWGGGFLA-NDGALDF 183          
BLAST of EY659312 vs. ExPASy Swiss-Prot
Match: Y661_METTH (Putative ammonium transporter MTH_661 OS=Methanobacterium thermoautotrophicum GN=MTH_661 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.124e-17
Identity = 53/182 (29.12%), Postives = 86/182 (47.25%), Query Frame = 2
Query:  242 LNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAXMAFVPLWLIVSYTVGAFXLWGGGF------XCFTGGVM 769
            LN GD AW +IS  LV L +VPG+ + Y  + K++  +N+ F++  +   V + W  + Y + FG  +    G     +G   +   SA               +   P  P      FQ  FAAIT+ +++G+V+ R+   + + F+PLW  + Y   A  +WGGGF        F GG++
Sbjct:    3 LNSGDTAWMLISTALVILMTVPGVAMFYSGLTKRENVLNTIFLSFVSLGIVSLLWFLFGYGLIFGGDVSGIIGSH--QVGISLINLGSA---------------SKYAPTIPEGLFAIFQMTFAAITVALISGAVVERIKFSSWILFIPLWFALVYVPVAHWVWGGGFLQNLGVHDFAGGIV 167          
The following BLAST results are available for this feature:
BLAST of EY659312 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
AMT31_ORYSJ4.962e-8367.65Ammonium transporter 3 member 1 OS=Oryza sativa su... [more]
AMT32_ORYSJ1.351e-8062.92Ammonium transporter 3 member 2 OS=Oryza sativa su... [more]
AMT33_ORYSJ2.385e-7765.32Ammonium transporter 3 member 3 OS=Oryza sativa su... [more]
AMT22_ORYSJ5.889e-6857.99Ammonium transporter 2 member 2 OS=Oryza sativa su... [more]
AMT23_ORYSJ6.511e-6758.45Ammonium transporter 2 member 3 OS=Oryza sativa su... [more]
AMT2_ARATH1.604e-6557.80Ammonium transporter 2 OS=Arabidopsis thaliana GN=... [more]
AMT21_ORYSJ2.094e-6558.90Ammonium transporter 2 member 1 OS=Oryza sativa su... [more]
Y663_METTH3.060e-2433.71Putative ammonium transporter MTH_663 OS=Methanoba... [more]
AMT_AQUAE2.509e-1830.90Ammonia channel OS=Aquifex aeolicus GN=amt PE=1 SV... [more]
Y661_METTH2.124e-1729.12Putative ammonium transporter MTH_661 OS=Methanoba... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-G04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659312 ID=EY659312|Name=EY659312|organism=Citrus sinensis|type=EST|length=991bp
AGTCCTGGTNCCGGNATTCCCGGGCCCGACCCACGCGTCCGAGTAAATCA
CTGATCCATAACCATAACCACACAAGTTTACAACTACATGCTCTCTATAA
CAGCCTGTACAAAAAGAGACAAAGTACAAGAGCAAGCAATAGTATATAAT
AAGTGCAATAGCAATGGCTGCTGCTGCTGTTCCCCCGAACCCGGTCCCAA
TCGCCTACCAAGGTGGCACCTCGGCAGCAGTACCGGACTGGCTAAACAAA
GGCGACAACGCATGGCAGATGATCTCAGCAACACTCGTGGGTCTCCAAAG
CGTCCCGGGGCTCGTGATCCTCTACGGCAGCATCGTCAAGAAGAAATGGG
CAGTCAACTCAGCTTTCATGGCCCTTTACGCCTTCGCGGCCGTCGTCATT
TGTTGGGCCACCTGGGCTTACAAAATGTCCTTCGGTGACAAACTCTTGCC
CTTCTGGGGCAAAGCCGGACCTGCCTTGGGACAGAAGTTTCTCATCAAAC
AATCCGCCCTCCCCGAGACTACGCAGTTCCACGACGACGGTTCCGTTGAA
ACGGCAATGGTCTTGCCGTTTTATCCCATGGCTTCCATGGTTTGGTTCCA
GTGCGTGTTTGCTGCCATTACGTTGGTTATACTGGCCGGGTCCGTGCTGG
GGAGAATGAATATTAAGGCTNGGATGGCGTTTGTGCCGCTTTGGCTTATC
GTTTCGTACACGGTTGGGGCGTTCAGNCTGTGGGGGGGGGGGTTTNCTTG
TTTCACTGGGGGCGTCATGGACTACTNCCGTGGGCTACCGTATTCACCTC
TCCTTTTGGAATTGCCCGGCTCACTGCCCGTTACTGGGTGGGGGCCAAAA
TCCACAAAGGACAGAAAGAGATTTTCACCAATAACGTATTATGATGCTAC
CAGGGCCGGGGTTGCTTGGGATAGGAAAGGGCTTGTTTCAACGGGGGGAA
TCCGCCACCGGGAAAATTGACTCATAAAGGGCGGCCTCAAA
back to top