EY659306

Overview
NameEY659306
Unique NameEY659306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length906
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659306 vs. ExPASy Swiss-Prot
Match: E13L3_ARATH (Glucan endo-1,3-beta-glucosidase-like protein 3 OS=Arabidopsis thaliana GN=At5g08000 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.332e-28
Identity = 58/101 (57.43%), Postives = 71/101 (70.30%), Query Frame = 2
Query:  104 MAVYELLPLFLGFTGHSTANWCVCKDGLGDPDVQKAMDYACGAGADCNPIHSNGP*YNPNTVKAHWTYAVNSYFQTKGQAQGSCDISGSATVATTDPSTAG 406
            MA   L  L L   GH++A+WCVCK GL D  +QK +DYACG GADCNP H  G  +NP+ V+AH  YAVNS+FQ KGQA  SC+ +G+AT+ TTDPS  G
Sbjct:    1 MAPLVLYLLTLLMAGHTSASWCVCKTGLSDSVLQKTLDYACGNGADCNPTHPKGSCFNPDNVRAHCNYAVNSFFQKKGQASESCNFTGTATLTTTDPSYTG 101          
BLAST of EY659306 vs. ExPASy Swiss-Prot
Match: E13L2_ARATH (Glucan endo-1,3-beta-glucosidase-like protein 2 OS=Arabidopsis thaliana GN=At5g61130 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.848e-25
Identity = 53/101 (52.48%), Postives = 66/101 (65.35%), Query Frame = 2
Query:  104 MAVYELLPLFLGFTGHSTANWCVCKDGLGDPDVQKAMDYACGAGADCNPIHSNGP*YNPNTVKAHWTYAVNSYFQTKGQAQGSCDISGSATVATTDPSTAG 406
            MA   L  L L   GHS+A+WCVCK GL D  +Q  +DYACG GADCNP       +NP+ V++H  YAVNS+FQ KGQ+ GSC+  G+AT   +DPS  G
Sbjct:    1 MAALVLSLLLLSLAGHSSASWCVCKTGLSDTVLQATLDYACGNGADCNPTKPKQSCFNPDNVRSHCNYAVNSFFQKKGQSPGSCNFDGTATPTNSDPSYTG 101          
BLAST of EY659306 vs. ExPASy Swiss-Prot
Match: E13L4_ARATH (Glucan endo-1,3-beta-glucosidase-like protein At1g69295 OS=Arabidopsis thaliana GN=At1g69295 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.376e-19
Identity = 48/100 (48.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query:  104 MAVYELLPLFLGFTGHSTANWCVCKDGLGDPDVQKAMDYACGAGADCNPIHSNGP*YNPNTVKAHWTYAVNSYFQTKGQAQGSCDISGSATVATTDPSTA 403
            M+V   L L +    +S A +C+CK+G  +  +QKA+DYACG GADC  I   G  Y PNTVK H   AVNSY+Q K  +  +CD +G+A+ +TT PSTA
Sbjct:    1 MSVLLPLCLIISMFTYSNAAYCLCKEG-NEQVLQKAIDYACGNGADCTQIQPTGACYQPNTVKNHCDVAVNSYYQKKASSGATCDFNGAASPSTTPPSTA 99          
BLAST of EY659306 vs. ExPASy Swiss-Prot
Match: E13B_WHEAT (Glucan endo-1,3-beta-glucosidase OS=Triticum aestivum GN=GLC1 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.328e-15
Identity = 36/84 (42.86%), Postives = 52/84 (61.90%), Query Frame = 2
Query:  164 WCVCKDGLGDPDVQKAMDYACGAGADCNPIHSNGP*YNPNTVKAHWTYAVNSYFQTKGQAQGSCDISGSATVATTDPSTAG*PY 415
            WCV KDG    D+Q  ++YACG   DC PI S G  ++PN+++AH +Y +N+Y+Q  G    +CD  G+  V ++DPS  G  Y
Sbjct:  377 WCVAKDGANGTDLQNNINYACGF-VDCKPIQSGGACFSPNSLQAHASYVMNAYYQANGHTDLACDFKGTGIVTSSDPSYGGCKY 459          
BLAST of EY659306 vs. ExPASy Swiss-Prot
Match: E131_ARATH (Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis thaliana GN=At1g11820 PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.862e-15
Identity = 39/89 (43.82%), Postives = 55/89 (61.80%), Query Frame = 2
Query:  140 FTGHSTAN--WCVCKDGLGDPDVQKAMDYACGAG-ADCNPIHSNGP*YNPNTVKAHWTYAVNSYFQTKGQAQGSCDISGSATVATTDPS 397
            F  + T N  +C+  DG+    +Q A+D+ACG G ++C+ I      Y PN VK H ++A NSY+Q +G+A GSCD  G A + TTDPS
Sbjct:  262 FLANDTTNQTYCIAMDGVDAKTLQAALDWACGPGRSNCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTDPS 350          
BLAST of EY659306 vs. ExPASy Swiss-Prot
Match: E133_ARATH (Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis thaliana GN=At2g01630 PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 7.284e-14
Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  164 WCVCKDGLGDPDVQKAMDYACGAG-ADCNPIHSNGP*YNPNTVKAHWTYAVNSYFQTKGQAQGSCDISGSATVATTDPS 397
            +C+ K+ +    +Q A+D+ACG G  DC+ +      Y P+ V AH TYA N+Y+Q  G+A GSCD  G ATV TTDPS
Sbjct:  360 FCIAKEKVDRKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPS 438          
BLAST of EY659306 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 3.615e-13
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  152 STANWCVCKDGLGDPDVQKAMDYACGAGADCNPIHSNGP*YNPNTVKAHWTYAVNSYFQTKGQAQGSCDISGSATVATTDPS 397
            +++ WCV K G  + ++Q ++D+ACG G DC  I   G  + PN V +H  YA+N YFQ   +    CD S +ATV + +PS
Sbjct:  360 TSSGWCVPKKGATNEELQASLDWACGHGIDCGAIQPGGACFEPNNVVSHAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPS 441          
BLAST of EY659306 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.772e-11
Identity = 30/88 (34.09%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  137 GFTGHSTANWCVCKDGLGDPDVQKAMDYACGAG-ADCNPIHSNGP*YNPNTVKAHWTYAVNSYFQTKGQAQGSCDISGSATVATTDPS 397
            G  G  T  WC+        ++Q A+D+ACG G  DC+ +  + P + P+TV +H +YA N+Y+Q  G +   C  +G++     DPS
Sbjct:  382 GGGGGGTKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPS 469          
The following BLAST results are available for this feature:
BLAST of EY659306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
E13L3_ARATH2.332e-2857.43Glucan endo-1,3-beta-glucosidase-like protein 3 OS... [more]
E13L2_ARATH1.848e-2552.48Glucan endo-1,3-beta-glucosidase-like protein 2 OS... [more]
E13L4_ARATH3.376e-1948.00Glucan endo-1,3-beta-glucosidase-like protein At1g... [more]
E13B_WHEAT1.328e-1542.86Glucan endo-1,3-beta-glucosidase OS=Triticum aesti... [more]
E131_ARATH3.862e-1543.82Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis ... [more]
E133_ARATH7.284e-1446.84Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis ... [more]
E137_ARATH3.615e-1340.24Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis ... [more]
E1312_ARATH5.772e-1134.09Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-F10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659306 ID=EY659306|Name=EY659306|organism=Citrus sinensis|type=EST|length=906bp
GCCTCAGCTTANCTGCTGTGTGTGGGGAGACAAACTTTTCTCGGAGCCAA
ACAAACATTTGTTATTATTATCTCCTCTCTAAATCTCTTTCGCTCATTCA
TTTATGGCTGTTTACGAGCTTTTACCTCTCTTCCTTGGCTTCACTGGGCA
TTCAACTGCAAACTGGTGTGTTTGCAAAGATGGACTGGGTGACCCAGATG
TACAAAAAGCTATGGACTATGCTTGTGGAGCTGGGGCTGATTGTAACCCT
ATCCATTCCAATGGGCCTTGATACAACCCCAACACTGTCAAAGCTCACTG
GACATATGCTGTCAACAGCTATTTCCAAACAAAGGGTCAAGCTCAAGGCT
CTTGTGATATCTCCGGAAGTGCAACCGTAGCCACTACCGATCCCAGCACT
GCTGGCTGACCTTATACTTCAAGTGCCAACACTTTACGCACCACCACAAC
TTTCCCAACAACACCAGCTCACAGGTGCTGCAGGCACAACCACACCCACA
ACAGCTCCGTGCACTACCGCTGCAACGACTAACACACCAGGCAGCACCAC
TGCCGACACCAACACACCATCAACTGGAACTGGAGTGCTGGGAGGAGTTG
GTCCTGGCTTAAGCCCTTCGGGATCTGGTGTGCCCAACACATACTATACT
CATGGTGGGATGAGACTGCAAAACTCTGCCATGTCTTGGTTGCGTCCTCT
CTATGTCTCAGGCTCGATGCTCGTGTCGGGATGAAAGAAACATCAACATG
ACATCTACTAAGACGGACGATGTGCTCTATANCCNGTGTCCGTTATACTG
GATCTCAGTGTGCAGAGATGGATATGCATGTGATGGGGCTGATGATTATC
TAAGACACCTTATAGCTGGCNAAAGATGCTTGTGTTTTCTCTGCTACTGT
CAAAAG
back to top