EY659305

Overview
NameEY659305
Unique NameEY659305
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length883
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: CBP23_HORVU (Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.154e-55
Identity = 116/218 (53.21%), Postives = 145/218 (66.51%), Query Frame = 1
Query:  109 LDMAAMEQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTIVSKNTSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYCD---YATGQLSTS-CDQYQTL*VMAVRQIDLYNVYAPLCKS-SAPPPPTALVIREYDPCSE 747
            L   AME+LGPF V SDG TLY N Y+WN+ ANVLFLE+P+ V +SYSNT++DY   GDN T++D+Y FL NW ERFP+YK R+F+ITGE YAGHYVPQLAH I+    +   INLK I IGNA I+D   +K M D FWTHAL S ET   I+K C+   Y  G  S + CD        ++  ID+YN+YAP C+S     PP A  I  +DPC++
Sbjct:  146 LGYGAMEELGPFRVMSDGKTLYSNPYSWNHAANVLFLESPAGVGYSYSNTTADYGRSGDNGTAEDAYQFLDNWLERFPEYKGREFYITGESYAGHYVPQLAHAIL--RHASPDINLKGIMIGNAVINDWTDSKGMYDFFWTHALISDETADGISKNCNFTAYGAGVASNALCDAASDEVGESLADIDIYNIYAPNCQSEKLVTPPIAPSIDNFDPCTD 361          
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: SCP28_ARATH (Serine carboxypeptidase-like 28 OS=Arabidopsis thaliana GN=SCPL28 PE=2 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 3.667e-54
Identity = 90/195 (46.15%), Postives = 119/195 (61.03%), Query Frame = 1
Query:  121 AMEQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTIVSKN--TSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYC-DYATGQLSTSCDQYQTL*VMAVRQIDLYNVYAPLCKSSA 696
            A E++GPF VN DG TL  N YAWN VANVLFL++P+ V FSY+NTSSD    GD  T +D+Y FL  W ERFP+YK R F+I GE YAGHY+P+LA  IV++N       INLK I +GN  +DD    K M D +W H L S E+  ++ K+C + +      +C+      +     ID YN+ +P C + A
Sbjct:  100 ASEEVGPFRVNPDGKTLRLNLYAWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYIAGESYAGHYIPELAQLIVNRNKGAKNPTINLKGILMGNPLVDDYNDNKGMRDYWWNHGLISDESYNDLTKWCLNDSILFPKLNCNAALNQALSEFGDIDPYNINSPACTTHA 294          

HSP 2 Score: 63.5438 bits (153), Expect = 3.667e-54
Identity = 26/47 (55.32%), Postives = 31/47 (65.96%), Query Frame = 3
Query:    3 PKTAKTLFYYFAESPHSSSTKPMVLWLNGGP*CSSLGYGCHGTTGPF 143
            P   + LFY+  E+P  S TKP+VLWLNGGP CSS+ YG     GPF
Sbjct:   61 PAAGRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPF 107          
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: CBP22_HORVU (Serine carboxypeptidase II-2 (Fragment) OS=Hordeum vulgare GN=CXP;2-2 PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 8.128e-54
Identity = 94/219 (42.92%), Postives = 126/219 (57.53%), Query Frame = 1
Query:  127 EQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTIVSKN--TSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYCDYAT-GQLSTSCDQYQTL*VMAVRQIDLYNVYAPLCKSSAPPPPTALVIR---------EYDPCSE 747
            E++GPF VN+DG  ++ N Y+WN VAN+LFL++P  V +SYSNTS+D  + GD  T+ DS  FLT W ERFPQYK R+F++TGE YAGHYVPQLA  I   +  T    INLK   +GNA  DD      +    WT  L S +T   +N +CD+ +    S  CD+   +       ID Y+++ P C SS       +V R         +YDPC+E
Sbjct:   65 EEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILSNGDERTAKDSLVFLTKWLERFPQYKEREFYLTGESYAGHYVPQLAQAIKRHHEATGDKSINLKGYMVGNALTDDFHDHYGIFQYMWTTGLISDQTYKLLNIFCDFESFVHTSPQCDKILDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTE 283          

HSP 2 Score: 58.9214 bits (141), Expect = 8.128e-54
Identity = 23/42 (54.76%), Postives = 31/42 (73.81%), Query Frame = 3
Query:   21 LFYYFAESPHSSSTKPMVLWLNGGP*CSSLGYGCHGTTGPFH 146
            LFY+F E+ H  ++KP++LWLNGGP CSS+ +G     GPFH
Sbjct:   30 LFYWFFEAAHDPASKPLLLWLNGGPGCSSIAFGVGEEVGPFH 71          
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: SCP26_ARATH (Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.800e-53
Identity = 92/217 (42.40%), Postives = 126/217 (58.06%), Query Frame = 1
Query:  121 AMEQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTIVSKNTSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYCDYATGQ-LSTSCDQYQTL*VMAVRQIDLYNVYAPLCKSSAPPPPTAL-------VIREYDPCSE 747
            A E++GPF +N DG TLY N Y+WN +AN+LFLE+P+ V FSYSNT+SD    GD  T++D+Y FL  WFERFPQYK+R+F+I GE YAGHYVPQL+  +  K      IN K   +GNA IDD      + + +W H L S  T   +   C++ + +  S+ C +      +    ID Y++Y   CK  A    +         + R YDPC+E
Sbjct:   94 AAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQIVYEKR--NPAINFKGFIVGNAVIDDYHDYVGLFEYWWAHGLISDLTYHNLRITCEFGSSEHPSSKCTKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHPWMWRAYDPCTE 308          

HSP 2 Score: 54.6842 bits (130), Expect = 1.800e-53
Identity = 25/45 (55.56%), Postives = 31/45 (68.89%), Query Frame = 3
Query:   15 KTLFYYFAESPHSSS--TKPMVLWLNGGP*CSSLGYGCHGTTGPF 143
            + LFY+  ESP S +  +KP+VLWLNGGP CSS+ YG     GPF
Sbjct:   57 RALFYWLTESPPSENPESKPLVLWLNGGPGCSSVAYGAAEEIGPF 101          
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: SCP29_ARATH (Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana GN=SCPL29 PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 5.195e-53
Identity = 91/233 (39.06%), Postives = 130/233 (55.79%), Query Frame = 1
Query:  127 EQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTIVSKN--TSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYCDYATG-QLSTSCDQYQTL*VMAVRQIDLYNVYAPLCKSSAPP--------PPTALVIREYDPCSETSFIPIKRLPSASSS 792
            E++GPF + +DG TLY N+Y+WN  AN+LFL+ P  V +SYSNTSSD ++ GD  T++DS  FL  W ERFP+YK RDF+I GE YAGHY+PQL+  IV  N  + K  INLK   +GN  +DD      +    W+    S +T + +   C + +    S  C++   +    +  ID Y+V+ P C ++A          P T+ V  +YDPC+E        LP    +
Sbjct:  102 EEIGPFHIKADGKTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDFYIVGESYAGHYIPQLSEAIVKHNQGSDKNSINLKGYMVGNGLMDDFHDRLGLFQYIWSLGFISDQTYSLLQLQCGFESFIHSSKQCNKILEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPMTSRVSEQYDPCTEKHTTVYFNLPEVQKA 334          

HSP 2 Score: 56.225 bits (134), Expect = 5.195e-53
Identity = 24/46 (52.17%), Postives = 31/46 (67.39%), Query Frame = 3
Query:   15 KTLFYYFAESPHSSSTKPMVLWLNGGP*CSSLGYGCHGTTGPFHSK 152
            + LFY+  E+   + +KP+VLWLNGGP CSS+ YG     GPFH K
Sbjct:   65 RALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIK 110          
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: SCP40_ARATH (Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 5.865e-53
Identity = 110/218 (50.46%), Postives = 138/218 (63.30%), Query Frame = 1
Query:  109 LDMAAMEQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTIVSKNTSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYCDYATGQLST---SCDQYQTL*VMAVRQIDLYNVYAPLCKSS--APPPPTALVIREYDPCSE 747
            L   A+++LGPF V+SDG TL+RN YAWNN ANVLFLE+P+ V FSY+NT+SD    GD NT+ D+Y FL NW ERFP+YK RD +I GE YAGHYVPQLAHTI+  +  ++  NLK I IGNA I+D      M D F +HAL S ++ A +   CD  T   S     C        M    +D+YN+YAPLC +S     P     IRE+DPCS+
Sbjct:  139 LAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSDLEKHGDRNTAADNYIFLVNWLERFPEYKGRDLYIAGESYAGHYVPQLAHTILLHH--RSFFNLKGILIGNAVINDETDLMGMYDFFESHALISEDSLARLKSNCDLKTESASVMTEECAVVSDQIDMDTYYLDIYNIYAPLCLNSTLTRRPKRGTTIREFDPCSD 354          
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: SCP24_ARATH (Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.151e-52
Identity = 94/226 (41.59%), Postives = 131/226 (57.96%), Query Frame = 1
Query:  121 AMEQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTI--VSKNTSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYCDYATGQLSTSCDQYQTL*V-MAVRQIDLYNVYAPLCKSSAPPPPTA-------------LVIREYDPCSET 750
            A E++GPF +N  G  LY N++AWN  AN+LFLE+P+ V +SY+NTSSD ++ GD  T+ D+  FL  W  RFPQYK RDF+I GE YAGHYVPQLA  I   +K  SK IINLK   +GNA  D+   +   +  +WTHA+ S ++   I KYC++   ++S  CD      +      ID Y++Y P C ++     T               ++  YDPC+E+
Sbjct:   95 ASEEIGPFRINKTGSNLYLNKFAWNKDANLLFLESPAGVGYSYTNTSSDLKDSGDERTAQDNLIFLIKWLSRFPQYKYRDFYIAGESYAGHYVPQLAKKINDYNKAFSKPIINLKGFLVGNAVTDNQYDSIGTVTYWWTHAIISDKSYKSILKYCNFTVERVSDDCDNAVNYAMNHEFGDIDQYSIYTPTCVAAQQKKNTTGFFVRMKNTLLRRRLVSGYDPCTES 320          

HSP 2 Score: 52.373 bits (124), Expect = 1.151e-52
Identity = 24/44 (54.55%), Postives = 29/44 (65.91%), Query Frame = 3
Query:   15 KTLFYYFAESPHSSS-TKPMVLWLNGGP*CSSLGYGCHGTTGPF 143
            + LFY+  ES   S  TKP++LWLNGGP CSS+ YG     GPF
Sbjct:   59 RALFYWLTESSSPSPHTKPLLLWLNGGPGCSSIAYGASEEIGPF 102          
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: SCP23_ARATH (Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 7.363e-52
Identity = 86/218 (39.45%), Postives = 123/218 (56.42%), Query Frame = 1
Query:  121 AMEQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTIVSKN---TSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYCDYATGQLSTSCDQYQTL*VMAVRQIDLYNVYAPLCKSSAPPPP---TALVIR--EYDPCSET 750
            A E++GPF +N  G  LY N++ WN  AN+LFLE+P+ V FSY+NTSSD ++ GD  T+ ++  FL  W  RFPQY+ RDF+I GE YAGHYVPQLA  I   N    +  IINLK   +GN  +D +          W+HA+ S +T   I K+C +   + S  C+           +++ Y++Y+P C             L++   EYDPC+E+
Sbjct:   92 ASEEIGPFRINKTGSNLYLNKFTWNTEANILFLESPAGVGFSYTNTSSDLKDSGDERTAQENLIFLIKWMSRFPQYQYRDFYIVGESYAGHYVPQLAKKIHLYNKAFNNTPIINLKGFMVGNGDMDKHYDRLGAAMYAWSHAMISDKTYKSILKHCSFTADKTSDKCNWALYFAYREFGKVNGYSIYSPSCVHQTNQTKFLHGRLLVEEYEYDPCTES 309          

HSP 2 Score: 64.6994 bits (156), Expect = 7.363e-52
Identity = 27/43 (62.79%), Postives = 33/43 (76.74%), Query Frame = 3
Query:   15 KTLFYYFAESPHSSSTKPMVLWLNGGP*CSSLGYGCHGTTGPF 143
            ++LFY+  ESP SS TKP++LWLNGGP CSS+GYG     GPF
Sbjct:   57 RSLFYWLTESPSSSHTKPLLLWLNGGPGCSSIGYGASEEIGPF 99          
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: SCP25_ARATH (Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 6.135e-51
Identity = 96/233 (41.20%), Postives = 136/233 (58.37%), Query Frame = 1
Query:  121 AMEQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTIVSKN-TSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYCDYATGQLSTSCDQYQTL*VMAVRQ----IDLYNVYAPLCKSSA-----------------PPPPTALV--IREYDPCSE 747
            A E++GPF ++  G  LY N++AWN+++N+LFLE P+ V FSY+N SSD  N GD  T+ DS  FL  W  RFP+Y +R+ +ITGE YAGHYVPQLA  I++ N  SK  +NLK I +GNA  D++      +  +W+HA+ S  T  ++   CD++  + S  C   +TL   A+ Q    ID YN+YAP C  S+                 P  P +++  I  YDPC+E
Sbjct:   99 ASEEIGPFRISKGGSGLYLNKFAWNSISNLLFLEAPAGVGFSYTNRSSDLFNTGDRRTAKDSLQFLIQWLHRFPRYNHREIYITGESYAGHYVPQLAKEIMNYNKRSKNPLNLKGIMVGNAVTDNHYDNLGTVSYWWSHAMISDRTYHQLISTCDFSRQKESDEC---ETLYSYAMEQEFGNIDQYNIYAPPCNKSSDGGGSYNGSSGRRSMRLPHLPHSVLRKISGYDPCTE 328          

HSP 2 Score: 52.373 bits (124), Expect = 6.135e-51
Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 3
Query:    9 TAKTLFYYFAESPHSSSTKPMVLWLNGGP*CSSLGYGCHGTTGPF 143
            + ++LFY+  E+     +KP+V+WLNGGP CSS+ YG     GPF
Sbjct:   62 SGRSLFYWLTEASDLPLSKPLVIWLNGGPGCSSVAYGASEEIGPF 106          
BLAST of EY659305 vs. ExPASy Swiss-Prot
Match: SCP36_ARATH (Serine carboxypeptidase-like 36 OS=Arabidopsis thaliana GN=SCPL36 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 3.008e-50
Identity = 97/240 (40.42%), Postives = 140/240 (58.33%), Query Frame = 1
Query:  121 AMEQLGPFIVNSDG*TLYRNEYAWNNVANVLFLETPSRVRFSYSNTSSDYRNPGDNNTSDDSYTFLTNWFERFPQYKNRDFFITGEIYAGHYVPQLAHTIVSKNTSKTIINLKCISIGNAWIDDNLCTKRMLDSFWTHALNSYETNAEINKYCDYATGQLSTSCDQYQTL*VMAVRQIDLYNVYAPLCKSS--APPPPTALVIREYDPCSET---SFIPIKRLPSA--SSSXCDTYNWST 819
            A ++LGPF V+SDG TL+RN Y+WNN ANVLFLETP    FSYSN+  + +  GD  T++D+Y FL NW ERFP+YK RD +I G+ YAGHYVPQLA  I+ +N ++T+INL+ I IGN  ++  +         ++H L S +     NK+C  +       C             +D+YN+YAPLC +S  +  P     I + DPCS     +++ IK +  A  +++    Y W++
Sbjct:  125 AFKELGPFRVHSDGKTLFRNPYSWNNEANVLFLETPVGTGFSYSNSPINGKQ-GDKATAEDNYMFLVNWLERFPEYKGRDIYIAGQSYAGHYVPQLAQIILHRN-NQTLINLRGILIGNPSLNREIQDDFGYKFMFSHGLISQQQMDNYNKFCTDSDLYDWDKCHLASQKIEAQKTHLDIYNIYAPLCLNSTLSSEPKKCTTIMKADPCSGNYLKAYLNIKEVQEAIHANTTKIPYEWTS 362          

HSP 2 Score: 48.9062 bits (115), Expect = 3.008e-50
Identity = 22/41 (53.66%), Postives = 27/41 (65.85%), Query Frame = 3
Query:   21 LFYYFAESPHSSSTKPMVLWLNGGP*CSSLGYGCHGTTGPF 143
            L+YYF E+    +T P+V+W NGGP CSSLG G     GPF
Sbjct:   93 LYYYFVETIKPGNTTPLVIWFNGGPGCSSLG-GAFKELGPF 132          
The following BLAST results are available for this feature:
BLAST of EY659305 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
CBP23_HORVU2.154e-5553.21Serine carboxypeptidase II-3 OS=Hordeum vulgare GN... [more]
SCP28_ARATH3.667e-5446.15Serine carboxypeptidase-like 28 OS=Arabidopsis tha... [more]
CBP22_HORVU8.128e-5442.92Serine carboxypeptidase II-2 (Fragment) OS=Hordeum... [more]
SCP26_ARATH1.800e-5342.40Serine carboxypeptidase-like 26 OS=Arabidopsis tha... [more]
SCP29_ARATH5.195e-5339.06Serine carboxypeptidase-like 29 OS=Arabidopsis tha... [more]
SCP40_ARATH5.865e-5350.46Serine carboxypeptidase-like 40 OS=Arabidopsis tha... [more]
SCP24_ARATH1.151e-5241.59Serine carboxypeptidase 24 OS=Arabidopsis thaliana... [more]
SCP23_ARATH7.363e-5239.45Putative serine carboxypeptidase-like 23 OS=Arabid... [more]
SCP25_ARATH6.135e-5141.20Serine carboxypeptidase-like 25 OS=Arabidopsis tha... [more]
SCP36_ARATH3.008e-5040.42Serine carboxypeptidase-like 36 OS=Arabidopsis tha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-F09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659305 ID=EY659305|Name=EY659305|organism=Citrus sinensis|type=EST|length=883bp
ACCCCAAGACTGCGAAGACATTGTTCTACTATTTCGCTGAGTCCCCTCAC
AGTTCCTCCACCAAACCTATGGTGTTATGGCTAAATGGAGGTCCATGATG
CTCATCTCTTGGATATGGCTGCCATGGAACAACTGGGCCCTTTCATAGTA
AACAGCGATGGCTAAACCCTATACAGAAATGAATATGCTTGGAATAACGT
GGCAAATGTGCTATTCTTGGAGACACCATCAAGAGTCCGGTTCTCATATT
CAAATACCTCTTCAGACTACAGGAATCCCGGCGACAATAACACATCTGAC
GATTCTTATACTTTCCTCACGAATTGGTTCGAGAGATTTCCCCAATACAA
AAACCGTGACTTCTTTATTACTGGTGAGATCTATGCTGGCCACTATGTCC
CTCAACTTGCTCACACCATTGTCTCCAAGAACACAAGTAAAACAATCATC
AACCTCAAATGCATATCTATTGGGAATGCTTGGATAGATGATAATTTGTG
CACCAAAAGAATGTTAGACTCTTTCTGGACACATGCTCTCAATTCCTATG
AAACCAATGCCGAGATTAACAAATATTGTGACTATGCGACCGGTCAACTG
TCAACTTCGTGTGATCAATATCAAACTCTATGAGTTATGGCAGTTAGACA
GATTGATCTATACAACGTTTACGCTCCACTTTGCAAATCATCAGCACCAC
CACCTCCAACAGCCCTCGTTATCAGAGAATATGACCCCTGCTCCGAAACG
TCGTTTATACCTATTAAACGCTTGCCCAGTGCGAGCAGCTCTTNATGCGA
TACATACAACTGGTCAACTCGCANCGACTAGACATGGACCGACAGCCATN
AACTGTGCTTCCACATACAGCAGCTGGTAGCAG
back to top