EY659303

Overview
NameEY659303
Unique NameEY659303
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length807
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7645 contig Csv1_Contig7645:13..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT5C_ANOGA (Actin-5C OS=Anopheles gambiae GN=Act5C PE=2 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 4.503e-134
Identity = 238/248 (95.97%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQV 248          
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT4_BOMMO (Actin, cytoplasmic A4 OS=Bombyx mori GN=A4 PE=2 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 4.503e-134
Identity = 238/248 (95.97%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQV 248          
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT3_BOMMO (Actin, cytoplasmic A3 OS=Bombyx mori PE=3 SV=3)

HSP 1 Score: 477.248 bits (1227), Expect = 4.503e-134
Identity = 238/248 (95.97%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQV 248          
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT3B_HELAM (Actin-A3b, cytoplasmic OS=Helicoverpa armigera GN=actA3b PE=2 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 4.503e-134
Identity = 238/248 (95.97%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQV 248          
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT3A_HELAM (Actin, cytoplasmic A3a OS=Helicoverpa armigera GN=actA3a PE=2 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 4.503e-134
Identity = 238/248 (95.97%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQV 248          
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT2_DROME (Actin-42A OS=Drosophila melanogaster GN=Act42A PE=1 SV=3)

HSP 1 Score: 477.248 bits (1227), Expect = 4.503e-134
Identity = 238/248 (95.97%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQV 248          
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT1_DROME (Actin-5C OS=Drosophila melanogaster GN=Act5C PE=1 SV=4)

HSP 1 Score: 477.248 bits (1227), Expect = 4.503e-134
Identity = 238/248 (95.97%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQV 248          
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT2_ONCVO (Actin-2 OS=Onchocerca volvulus GN=act-2b PE=3 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 1.003e-133
Identity = 237/248 (95.56%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQV 248          
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT1_ONCVO (Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 1.003e-133
Identity = 237/248 (95.56%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQV 248          
BLAST of EY659303 vs. ExPASy Swiss-Prot
Match: ACT4_ARTSX (Actin, clone 403 OS=Artemia sp. PE=2 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 1.310e-133
Identity = 237/248 (95.56%), Postives = 238/248 (95.97%), Query Frame = 1
Query:   64 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTX*REIVRDIKEKLCYVALDFEQRMGTAAXSKLLEKSYEWLMGQV 807
            MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT  REIVRDIKEKLCYVALDFEQ M TAA S  LEKSYE   GQV
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSTSLEKSYELPDGQV 248          
The following BLAST results are available for this feature:
BLAST of EY659303 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 483
Match NameE-valueIdentityDescription
ACT5C_ANOGA4.503e-13495.97Actin-5C OS=Anopheles gambiae GN=Act5C PE=2 SV=1[more]
ACT4_BOMMO4.503e-13495.97Actin, cytoplasmic A4 OS=Bombyx mori GN=A4 PE=2 SV... [more]
ACT3_BOMMO4.503e-13495.97Actin, cytoplasmic A3 OS=Bombyx mori PE=3 SV=3[more]
ACT3B_HELAM4.503e-13495.97Actin-A3b, cytoplasmic OS=Helicoverpa armigera GN=... [more]
ACT3A_HELAM4.503e-13495.97Actin, cytoplasmic A3a OS=Helicoverpa armigera GN=... [more]
ACT2_DROME4.503e-13495.97Actin-42A OS=Drosophila melanogaster GN=Act42A PE=... [more]
ACT1_DROME4.503e-13495.97Actin-5C OS=Drosophila melanogaster GN=Act5C PE=1 ... [more]
ACT2_ONCVO1.003e-13395.56Actin-2 OS=Onchocerca volvulus GN=act-2b PE=3 SV=1[more]
ACT1_ONCVO1.003e-13395.56Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1[more]
ACT4_ARTSX1.310e-13395.56Actin, clone 403 OS=Artemia sp. PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-F06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659303 ID=EY659303|Name=EY659303|organism=Citrus sinensis|type=EST|length=807bp
CTCAAGTGACGTTTGTCCCAGTGTTCCACGATTCTCTAACGTACTAATTT
CAACAAATTCAAAATGTGTGACGAAGAAGTAGCAGCACTCGTTGTCGACA
ATGGATCCGGTATGTGCAAAGCCGGTTTTGCCGGTGATGATGCTCCCAGA
GCCGTATTCCCCTCAATCGTCGGTCGCCCAAGGCATCAGGGTGTCATGGT
TGGTATGGGACAAAAAGACAGTTATGTTGGAGATGAAGCTCAATCTAAGA
GAGGTATCCTTACCTTGAAATACCCCATCGAACACGGTATTGTCACAAAC
TGGGACGATATGGAGAAGATCTGGCATCACACCTTCTACAATGAACTCCG
AGTAGCGCCAGAAGAACACCCTGTCCTCTTGACAGAAGCTCCCCTGAACC
CAAAAGCTAACAGAGAAAAGATGACCCAAATCATGTTTGAAACCTTCAAC
ACACCCGCCATGTATGTAGCTATCCAAGCTGTTCTCTCTCTGTATGCTTC
TGGTCGTACCACTGGTATCGTTCTTGATTCAGGAGATGGTGTTTCCCACA
CAGTGCCAATCTATGAAGGGTATGCCTTACCTCATGCTATCCTNCGTTTG
GACTTGGCTGGTCGTGACTTGACCGACTACCTCATGAAGATCCTTACAGA
AAGAGGNTACAGTTTCACAACCACANGCTGAAGAGAAATCGTCCGTGATA
TCAAAGAAAAATTATGTTATGTAGCTTTAGACTTTGAACAAAGAATGGGC
ACCGCTGCTTNCTCAAAGCTCCTAGAAAAATCCTATGAATGGCTGATGGG
NCAAGTA
back to top