EY659298

Overview
NameEY659298
Unique NameEY659298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length919
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7469 contig Csv1_Contig7469:1..920. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHRP_TOBAC (Glutathione reductase, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GOR PE=1 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 3.037e-93
Identity = 166/233 (71.24%), Postives = 189/233 (81.12%), Query Frame = 1
Query:  136 ATSVTTPKLTTTFYNRLPITVPLSSHF--LSLQNTLTPF-----SHNCFSLLYFQC-RRRHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGXPXIPDI 810
            ATS++TPKL+TT  +    ++     F  LSL N + P      +H+  +     C RRR  A RA+S NGA+ P HYDFDLFTIGAGSGGVRASRFA+NFGASVA+CELPFSTISS++TGGVGGTCVLRGCVPKKLLVYASK+SHEF+ES GFGW Y  EP+ DWSTLIANKNAELQRLTGIYKNIL NAG+TLIEGRGK+VDPHTVDVDGKLYSA++ILISVGG P IPDI
Sbjct:    1 ATSLSTPKLSTTLSSPTLHSLLYKHKFSLLSLSNPIKPLHFNFLTHSRSTPSSLSCTRRRFTAPRAESSNGADAPRHYDFDLFTIGAGSGGVRASRFASNFGASVAVCELPFSTISSDSTGGVGGTCVLRGCVPKKLLVYASKYSHEFEESCGFGWNYDVEPRFDWSTLIANKNAELQRLTGIYKNILKNAGVTLIEGRGKVVDPHTVDVDGKLYSAKNILISVGGRPFIPDI 233          

HSP 2 Score: 41.5874 bits (96), Expect = 3.037e-93
Identity = 20/24 (83.33%), Postives = 21/24 (87.50%), Query Frame = 3
Query:  813 GSEYAIDSDAALDLPSKAEKIAXV 884
            GSEYAIDSDAALDLP+K  KIA V
Sbjct:  235 GSEYAIDSDAALDLPTKPNKIAIV 258          
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHRP_PEA (Glutathione reductase, chloroplastic/mitochondrial OS=Pisum sativum GN=GR PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 2.144e-88
Identity = 157/228 (68.86%), Postives = 179/228 (78.51%), Query Frame = 1
Query:  133 MATSVTTPKLT--TTFYNRLPITVPLSSHFLSLQNTLTPFSHNCFSLLYFQCRRRHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGXPXIPDI 810
            ++ S  +P LT  T F+ +   T P S  F       TP   +  +L+      R  A RA+S NGA+    YDFDLFTIGAGSGGVRASRFA+NFGAS A+CELPFSTISS+TTGGVGGTCV+RGCVPKKLLVYASKFSHEF+ESNGFGW+Y +EP+HDWS+LIANKNAELQRLTGIYKN L NAG+ LIEGRGKIVD HTVDVDGKLYSA+HIL+SVGG P IPDI
Sbjct:    9 LSLSCCSPTLTRSTLFFTK---TFPFSRSFS------TPLPLSTKTLISLSPPHRTFAVRAESQNGADPARQYDFDLFTIGAGSGGVRASRFASNFGASSAVCELPFSTISSDTTGGVGGTCVIRGCVPKKLLVYASKFSHEFEESNGFGWRYDSEPKHDWSSLIANKNAELQRLTGIYKNTLKNAGVKLIEGRGKIVDAHTVDVDGKLYSAKHILVSVGGRPFIPDI 227          

HSP 2 Score: 41.9726 bits (97), Expect = 2.144e-88
Identity = 20/24 (83.33%), Postives = 21/24 (87.50%), Query Frame = 3
Query:  813 GSEYAIDSDAALDLPSKAEKIAXV 884
            G EYAIDSDAALDLPSK +KIA V
Sbjct:  229 GKEYAIDSDAALDLPSKPQKIAIV 252          
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHRP_ARATH (Glutathione reductase, chloroplastic OS=Arabidopsis thaliana GN=EMB2360 PE=2 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.378e-87
Identity = 161/241 (66.80%), Postives = 184/241 (76.35%), Query Frame = 1
Query:  148 TTPKLTTTFYN----------RLPITVPL----SSHFLSLQNTLTPFS--HNCFSLL----YFQCRRRHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGXPXIPDI 810
            +TPKLT+T  +          +LPI + L    SS FLSL  TLT         +LL    Y+  RR  V A   +DNGAE   HYDFDLFTIGAGSGGVRASRFA +FGAS A+CELPFSTISS+T GGVGGTCVLRGCVPKKLLVYASK+SHEF++S+GFGWKY TEP HDW+TLIANKNAELQRLTGIYKNIL  A + LIEGRGK++DPHTVDVDGK+Y+ R+ILI+VGG P IPDI
Sbjct:    3 STPKLTSTISSSSPSLQFLCKKLPIAIHLPSSSSSSFLSLPKTLTSLYSLRPRIALLSNHRYYHSRRFSVCA--STDNGAESDRHYDFDLFTIGAGSGGVRASRFATSFGASAAVCELPFSTISSDTAGGVGGTCVLRGCVPKKLLVYASKYSHEFEDSHGFGWKYETEPSHDWTTLIANKNAELQRLTGIYKNILSKANVKLIEGRGKVIDPHTVDVDGKIYTTRNILIAVGGRPFIPDI 241          

HSP 2 Score: 40.0466 bits (92), Expect = 1.378e-87
Identity = 19/24 (79.17%), Postives = 21/24 (87.50%), Query Frame = 3
Query:  813 GSEYAIDSDAALDLPSKAEKIAXV 884
            G E+AIDSDAALDLPSK +KIA V
Sbjct:  243 GKEFAIDSDAALDLPSKPKKIAIV 266          
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHRP_SOYBN (Glutathione reductase, chloroplastic OS=Glycine max GN=GR PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.416e-81
Identity = 166/247 (67.21%), Postives = 191/247 (77.33%), Query Frame = 1
Query:  133 MATSVTTP---KLTTTFYNR-LPITVPLSSHFLSLQNTLTPFSHNCFSLLYFQCRRRHVAARAKSDNGAE-LPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGXPXIPDI----LAVNMQ*ILMLP 846
            MATS++      L T F  + LP++ P    FLSL     P      SLL    RRR    RA+S NG + +P+HYDFDLFTIGAGSGGVRA RFAAN+GASVAICELPFSTISSETTG VGGTCV+RGCVPKKLLVYASKFSHEF+ESNGFGW+Y +EP+HDWS+ IANKNAELQRLTGIYKNIL NAG+ LIEG GK++DPHTVDV+GKLYSA+HIL++VGG P IPDI    LA++    L LP
Sbjct:    1 MATSLSVSPSLSLNTLFIAKALPLSRP---SFLSL-----PLPK---SLLSLSTRRRTFIVRAESQNGRDPVPAHYDFDLFTIGAGSGGVRARRFAANYGASVAICELPFSTISSETTG-VGGTCVIRGCVPKKLLVYASKFSHEFEESNGFGWRYDSEPKHDWSSFIANKNAELQRLTGIYKNILNNAGVKLIEGHGKMIDPHTVDVNGKLYSAKHILVAVGGRPFIPDIPGKELAIDSDAALDLP 235          
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHR_PSEAE (Glutathione reductase OS=Pseudomonas aeruginosa GN=gor PE=3 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.338e-47
Identity = 88/156 (56.41%), Postives = 118/156 (75.64%), Query Frame = 1
Query:  343 YDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGXPXIPDI 810
            +DFDLF IGAGSGGVRA+RFAA FGA VA+ E  +          +GGTCV  GCVPKKLLVY + FS +F+++  +GW  G E Q DW+TLI NKN E+QRL GIY+N+L+N+G+TL+EG  +++D H+V+VDG+ +SA+HIL++ GG P +PDI
Sbjct:    3 FDFDLFVIGAGSGGVRAARFAAGFGARVAVAESRY----------LGGTCVNVGCVPKKLLVYGAHFSEDFEQARAYGWSAG-EAQFDWATLIGNKNREIQRLNGIYRNLLVNSGVTLLEGHARLLDAHSVEVDGQRFSAKHILVATGGWPQVPDI 147          
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHRC_PEA (Glutathione reductase, cytosolic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.133e-46
Identity = 95/168 (56.55%), Postives = 115/168 (68.45%), Query Frame = 1
Query:  322 GAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDV---DG-KL-YSARHILISVGGXPXIPDI 810
            G E    YDFDLF IGAGSGGVRA+RF++NFGA V ICELPF  ISSET GGVGGTCV+RGCVPKK+LVY + +  E  ++  FGW+       +W  L+  K  E+ RL GIYK +L NAG+ L EG GKI  P+ V+V   DG KL YSA+HILI+ G     P+I
Sbjct:   16 GEEQGKVYDFDLFIIGAGSGGVRAARFSSNFGAKVGICELPFHPISSETIGGVGGTCVIRGCVPKKILVYGASYGGELQDARNFGWELNENVDFNWKKLLQKKTDEINRLNGIYKRLLSNAGVKLFEGEGKIASPNEVEVTQLDGTKLSYSAKHILIATGSRAQRPNI 183          
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHRC_ORYSJ (Glutathione reductase, cytosolic OS=Oryza sativa subsp. japonica GN=GRC2 PE=2 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 2.790e-45
Identity = 88/153 (57.52%), Postives = 113/153 (73.86%), Query Frame = 1
Query:  343 YDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDV---DG--KLYSARHILISVG 786
            YD+DLF IGAGSGGVR SR +A+FGA VAICELPF  ISS+  GG GGTCV+RGCVPKK+LVY S F  EF+++  FGW+   +   +W  L+ NK  E+ RL G+Y+ IL N+G+T+IEG G +VD HTV+V   DG  + Y+A+HILI+ G
Sbjct:   21 YDYDLFVIGAGSGGVRGSRTSASFGAKVAICELPFHPISSDWQGGHGGTCVIRGCVPKKILVYGSSFRGEFEDAKNFGWEINGDINFNWKRLLENKTQEIVRLNGVYQRILGNSGVTMIEGAGSLVDAHTVEVTKPDGSKQRYTAKHILIATG 173          
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHRP_SPIOL (Glutathione reductase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 6.215e-45
Identity = 92/163 (56.44%), Postives = 114/163 (69.94%), Query Frame = 1
Query:  337 SHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDV---DG-KL-YSARHILISVGGXPXIPDI 810
            ++YDFDLF IGAGSGGVRA+RF+AN GA V ICELPF  ISSE  GGVGGTCV+RGCVPKK+LVY + F  E +++  +GW+   +   +W  L+  K  E+ RL  IYK +L NAG+ L EG GKIV P+ V V   DG KL YSA+HILI+ G     P+I
Sbjct:   12 ANYDFDLFVIGAGSGGVRAARFSANLGAKVGICELPFHPISSEVIGGVGGTCVIRGCVPKKILVYGASFGGELEDAKNYGWELNEKIDFNWKKLLQKKTDEIIRLNNIYKRLLSNAGVKLYEGEGKIVGPNEVQVTQLDGTKLSYSAKHILIATGSRAQRPNI 174          
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHRC_BRARP (Glutathione reductase, cytosolic OS=Brassica rapa subsp. pekinensis GN=GR1 PE=2 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 6.872e-44
Identity = 89/173 (51.45%), Postives = 114/173 (65.90%), Query Frame = 1
Query:  307 AKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDV---DGK--LYSARHILISVGGXPXIPDI 810
            A +   A   +HYDFDLF IGAGSGGVRA+RF+AN GA V ICELPF  ISSE  GGVGGTCV+RGCVPKK+LVY + +  E +++  +GW+       +W  L+  K  E+ RL  IYK +L NA + L EG G+IV P+ V+V   DG    Y+A+HILI+ G     P+I
Sbjct:   15 AAAGEEATTETHYDFDLFVIGAGSGGVRAARFSANNGAKVGICELPFHPISSEEIGGVGGTCVIRGCVPKKILVYGATYGGELEDARNYGWEINGNVDFNWKKLLQKKTDEILRLNNIYKRLLANAAVKLYEGEGRIVGPNEVEVRQIDGTKISYTAKHILIATGSRAQKPNI 187          
BLAST of EY659298 vs. ExPASy Swiss-Prot
Match: GSHRC_ARATH (Glutathione reductase, cytosolic OS=Arabidopsis thaliana GN=At3g24170 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 8.975e-44
Identity = 86/163 (52.76%), Postives = 111/163 (68.10%), Query Frame = 1
Query:  337 SHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDV---DGK--LYSARHILISVGGXPXIPDI 810
            +HYDFDLF IGAGSGGVRA+RF+AN GA V ICELPF  ISSE  GGVGGTCV+RGCVPKK+LVY + +  E +++  +GW+   +    W  L+  K  E+ RL  IYK +L NA + L EG G++V P+ V+V   DG    Y+A+HILI+ G     P+I
Sbjct:   22 THYDFDLFVIGAGSGGVRAARFSANHGAKVGICELPFHPISSEEIGGVGGTCVIRGCVPKKILVYGATYGGELEDAKNYGWEINEKVDFTWKKLLQKKTDEILRLNNIYKRLLANAAVKLYEGEGRVVGPNEVEVRQIDGTKISYTAKHILIATGSRAQKPNI 184          
The following BLAST results are available for this feature:
BLAST of EY659298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 61
Match NameE-valueIdentityDescription
GSHRP_TOBAC3.037e-9371.24Glutathione reductase, chloroplastic (Fragment) OS... [more]
GSHRP_PEA2.144e-8868.86Glutathione reductase, chloroplastic/mitochondrial... [more]
GSHRP_ARATH1.378e-8766.80Glutathione reductase, chloroplastic OS=Arabidopsi... [more]
GSHRP_SOYBN2.416e-8167.21Glutathione reductase, chloroplastic OS=Glycine ma... [more]
GSHR_PSEAE1.338e-4756.41Glutathione reductase OS=Pseudomonas aeruginosa GN... [more]
GSHRC_PEA1.133e-4656.55Glutathione reductase, cytosolic OS=Pisum sativum ... [more]
GSHRC_ORYSJ2.790e-4557.52Glutathione reductase, cytosolic OS=Oryza sativa s... [more]
GSHRP_SPIOL6.215e-4556.44Glutathione reductase, chloroplastic (Fragment) OS... [more]
GSHRC_BRARP6.872e-4451.45Glutathione reductase, cytosolic OS=Brassica rapa ... [more]
GSHRC_ARATH8.975e-4452.76Glutathione reductase, cytosolic OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-E12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659298 ID=EY659298|Name=EY659298|organism=Citrus sinensis|type=EST|length=919bp
ACAACCCAAATCGGAACTGAATTTGAAACCGAACCGAACGGAAAAAAATT
TCAACCTGTTTGAGTTGAAATCTTAAACCCGAATGGACCTGAACTGAAAA
CCCTAAAACCAAACTGAATAATTTTTAAAGAAATGGCAACTTCTGTTACA
ACTCCAAAGCTCACAACAACCTTCTATAACAGACTACCAATTACAGTCCC
ACTCTCTTCTCACTTTCTTTCGCTACAAAATACCCTAACTCCATTCTCTC
ACAATTGCTTCTCGCTTCTTTATTTTCAATGCCGACGCCGCCACGTTGCG
GCTCGAGCCAAGTCTGATAATGGAGCTGAGCTGCCGAGCCACTACGACTT
TGACCTCTTCACTATCGGTGCCGGCAGCGGTGGCGTCCGCGCCTCCCGTT
TTGCTGCCAATTTTGGCGCTTCTGTGGCCATTTGTGAACTTCCATTTTCC
ACCATTTCTTCCGAAACCACGGGCGGCGTTGGCGGCACGTGTGTACTTCG
TGGATGTGTGCCAAAGAAGCTTTTGGTGTACGCGTCAAAATTTTCTCATG
AATTCGATGAGAGTAATGGTTTTGGATGGAAATATGGGACGGAACCGCAG
CATGATTGGAGCACTTTGATTGCTAACAAAAATGCTGAGTTGCAGCGCCT
TACCGGTATCTACAAGAACATTCTAATCAATGCTGGCATTACCTTAATTG
AAGGTCGTGGAAAGATTGTGGACCCACACACTGTTGATGTGGATGGGAAA
CTGTATTCAGCTAGGCACATACTGATTTCGGTTGGGGGACNGCCTTNCAT
TCCTGACATTCTGGCAGTGAATATGCAATAGATTCTGATGCTGCCCTTGA
TTTGCCCTCGAAAGCTGAGAAAATTGCATTNGTTGTGGTGGNAACATTGC
CTNGNAATTGCTGGCATCT
back to top