EY659296

Overview
NameEY659296
Unique NameEY659296
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length897
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8110 contig Csv1_Contig8110:114..1011. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: CADH7_ARATH (Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis thaliana GN=CAD7 PE=1 SV=2)

HSP 1 Score: 292.738 bits (748), Expect = 3.973e-96
Identity = 141/210 (67.14%), Postives = 160/210 (76.19%), Query Frame = 2
Query:   47 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSPSKR 676
            K AFG AA+D SG+LSPF FSRRATGEKDV FKV  CGICH+DL + KNEWG   YP+VPGHEIVGVVTEVG+KV KF  GDKVGVG M GSCRSCDSC    ENYCPK+I+T  +K  D T+T+GGYSD MV  E F++RIP+  PLD  APLLCAG+TVYSP++++GLDKPGM             AVKFAKAMG KVTVISTS  KR
Sbjct:    7 KEAFGLAAKDESGILSPFSFSRRATGEKDVRFKVLFCGICHTDLSMAKNEWGLTTYPLVPGHEIVGVVTEVGAKVKKFNAGDKVGVGYMAGSCRSCDSCNDGDENYCPKMILTSGAKNFDDTMTHGGYSDHMVCAEDFIIRIPDNLPLDGAAPLLCAGVTVYSPMKYHGLDKPGMHIGVVGLGGLGHVAVKFAKAMGTKVTVISTSERKR 216          

HSP 2 Score: 81.2629 bits (199), Expect = 3.973e-96
Identity = 43/77 (55.84%), Postives = 54/77 (70.13%), Query Frame = 1
Query:  670 QESEAVERLGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPLMXLVKSQGSLYXLVHPRSTXATS-FPLLTGR 897
            +  EAV RLGAD+FLVSRD  +M+ AMG MDGIIDTVSA HPL+PL+ L+K++G L  +  P        FPL+ GR
Sbjct:  215 KRDEAVTRLGADAFLVSRDPKQMKDAMGTMDGIIDTVSATHPLLPLLGLLKNKGKLVMVGAPAEPLELPVFPLIFGR 291          
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: MTDH_MESCR (Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 1.560e-93
Identity = 161/229 (70.31%), Postives = 182/229 (79.48%), Query Frame = 2
Query:   26 APEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSPSKRVKPLNVLALIPF 712
            APE  HP+ AFGWAARDTSG LSP  FSRRATGE+DVTFKV +CGICHSDLH IKNEWGNA+YP +PGHEIVGVVTEVG+KV  FKVGDKVGVGCMVGSCRSC+SC   LENYCPK+I+TY S Y+DGT+TYGGYSD MV +EHF VRIP+   LDATAPLLCAG+TVYSPL+ + LDKPG+             AVKF KA G KVTVISTSP+K+ + +N L    F
Sbjct:    5 APENVHPQKAFGWAARDTSGTLSPLKFSRRATGEQDVTFKVLYCGICHSDLHYIKNEWGNAVYPAIPGHEIVGVVTEVGNKVQNFKVGDKVGVGCMVGSCRSCESCENHLENYCPKMILTYGSTYYDGTLTYGGYSDIMVVEEHFAVRIPDNMALDATAPLLCAGVTVYSPLKHFELDKPGLHIGVVGLGGLGHMAVKFGKAFGAKVTVISTSPNKKDEAVNRLGADSF 233          

HSP 2 Score: 87.4261 bits (215), Expect = 1.188e-16
Identity = 45/79 (56.96%), Postives = 59/79 (74.68%), Query Frame = 1
Query:  664 P*QESEAVERLGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPLMXLVKSQGSLYXL-VHPRSTXATSFPLLTGR 897
            P ++ EAV RLGADSF+VSR+ ++MQ+AMG +DGIIDTVSA HPL+PL+ L+KSQG +  + V  +      FPLL GR
Sbjct:  218 PNKKDEAVNRLGADSFVVSREPEQMQSAMGTLDGIIDTVSAAHPLLPLLGLLKSQGKMIMVGVPDKPLELPVFPLLQGR 296          
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: MTDH_FRAAN (Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 2.037e-93
Identity = 163/229 (71.18%), Postives = 183/229 (79.91%), Query Frame = 2
Query:   26 APEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSPSKRVKPLNVLALIPF 712
            A EQEH K A GWAARD+SGVLSPF+F RR TGEKDVTFKV +CGICHSDLH++KNEWG + YP+VPGHEIVG VTEVGSKV KFKVGD+VGVGC+VGSCRSC++C   LENYCPK I+TY +KY+DG+ TYGGYSD MVADEHF+VRIP+  PLD  APLLCAGIT YSPLR++GLDKPGM             AVKFAKAMGVKVTVISTSP K  + L  L    F
Sbjct:    2 AIEQEHRKKASGWAARDSSGVLSPFNFYRRETGEKDVTFKVLYCGICHSDLHMVKNEWGFSTYPLVPGHEIVGEVTEVGSKVQKFKVGDRVGVGCIVGSCRSCENCTDHLENYCPKQILTYGAKYYDGSTTYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGLDKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKEEEALKHLGADSF 230          

HSP 2 Score: 89.7373 bits (221), Expect = 2.393e-17
Identity = 48/79 (60.76%), Postives = 58/79 (73.42%), Query Frame = 1
Query:  664 P*QESEAVERLGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPLMXLVKSQGSLYXLVHP-RSTXATSFPLLTGR 897
            P +E EA++ LGADSFLVSRDQD+MQAA+G MDGIIDTVSA HPL+PL+ L+ S G L  +  P +      FPLL GR
Sbjct:  215 PKKEEEALKHLGADSFLVSRDQDQMQAAIGTMDGIIDTVSAQHPLLPLIGLLNSHGKLVMVGAPEKPLELPVFPLLMGR 293          
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: MTDH3_STYHU (Probable mannitol dehydrogenase 3 OS=Stylosanthes humilis GN=CAD3 PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 2.356e-90
Identity = 133/213 (62.44%), Postives = 162/213 (76.06%), Query Frame = 2
Query:   32 EQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDAT-APLLCAGITVYSPLRFYGLDKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSP 667
            E EHP+ AFGWAARD+SG+LSPF+FSRR  GE+DV  +V +CGICH+DLH+ KN++GN+IYP VPGHE++G+V EVGSKV K+KVGDKVGVG  V SCRSC +C  +LENYCPK I+T   K+ DGT TYGGYSD+MV DEHFV RIPEG PLD   +  LC G + +SPL++YGLDKPG+               KFAK  G+K+TVISTSP
Sbjct:    7 EFEHPRKAFGWAARDSSGLLSPFNFSRRDIGEEDVALEVLYCGICHTDLHMAKNDFGNSIYPYVPGHEVIGIVAEVGSKVEKYKVGDKVGVGYFVESCRSCQNCIDNLENYCPKHILTQGDKHIDGTTTYGGYSDSMVVDEHFVTRIPEGLPLDGCGSSSLCWGYS-HSPLKYYGLDKPGLHVGVVGLGGLGHMVAKFAKTHGLKITVISTSP 218          

HSP 2 Score: 73.559 bits (179), Expect = 2.356e-90
Identity = 39/79 (49.37%), Postives = 53/79 (67.09%), Query Frame = 1
Query:  664 P*QESEAVERLGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPLMXLVKSQGSLYXL-VHPRSTXATSFPLLTGR 897
            P ++ EA++ LGADSFLVSRD D+M+A    +DGIIDTVSA H ++PL+ L+KS G L  +    +      FPL+ GR
Sbjct:  219 PTKKEEAIKNLGADSFLVSRDPDQMEAPKETLDGIIDTVSADHSIVPLIGLLKSHGKLVLIGAIEKPLELPPFPLILGR 297          
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: CADH6_ARATH (Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 1.270e-88
Identity = 128/222 (57.66%), Postives = 161/222 (72.52%), Query Frame = 2
Query:   32 EQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSPSKRVKPLNVL 697
            E+E    AFGWAARD+SG LSPF FSRR TGE++V  KV +CGICHSDLH +KNEW ++IYP+VPGHEI+G V+E+G+KVSKF +GDKVGVGC+V SCR+C+SC  D ENYC K I TY   +HDGTI YGGYSD +V DE + V+IP   PL + APLLCAGI++YSP++++GL  P                V+FAKA G KVTV+S++  K    L+ L
Sbjct:    7 EKEQSVEAFGWAARDSSGHLSPFVFSRRKTGEEEVRVKVLYCGICHSDLHCLKNEWHSSIYPLVPGHEIIGEVSEIGNKVSKFNLGDKVGVGCIVDSCRTCESCREDQENYCTKAIATYNGVHHDGTINYGGYSDHIVVDERYAVKIPHTLPLVSAAPLLCAGISMYSPMKYFGLTGPDKHVGIVGLGGLGHIGVRFAKAFGTKVTVVSSTTGKSKDALDTL 228          

HSP 2 Score: 74.3294 bits (181), Expect = 1.270e-88
Identity = 39/77 (50.65%), Postives = 53/77 (68.83%), Query Frame = 1
Query:  670 QESEAVERLGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPLMXLVKSQGSLYXL-VHPRSTXATSFPLLTGR 897
            +  +A++ LGAD FLVS D+D+M+AAMG MDGIIDTVSA H + PL+ L+KS G L  L    +    ++F L+ GR
Sbjct:  220 KSKDALDTLGADGFLVSTDEDQMKAAMGTMDGIIDTVSASHSISPLIGLLKSNGKLVLLGATEKPFDISAFSLILGR 296          
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: GEDH1_OCIBA (Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.083e-86
Identity = 151/232 (65.09%), Postives = 176/232 (75.86%), Query Frame = 2
Query:   17 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSPSKRVKPLNVLALIPF 712
            M ++PE EHP  A GWAA D SG  SPF+FSRRATGE+DV F+V +CG+CHSDLH++KNEWG   YPIVPGHEIVG+VTEVGSKV K K+GDKVGVG +VGSCR CD C+ DLENYC K I+TY + Y DGTI  GGYSD MVADEHF++R PE  PLDA APLLCAGIT YSPL+++GLDKPG+             AVKFAKA G KVTVISTS SK+ + +  L +  F
Sbjct:    1 MAKSPETEHPVKALGWAATDNSGTFSPFNFSRRATGERDVQFRVLYCGVCHSDLHMVKNEWGVTHYPIVPGHEIVGIVTEVGSKVEKVKIGDKVGVGVLVGSCRQCDQCSNDLENYCYKQILTYGAPYLDGTIARGGYSDIMVADEHFIIRWPENFPLDAGAPLLCAGITTYSPLKYFGLDKPGLRVGVNGLGGLGHVAVKFAKAFGTKVTVISTSLSKKEEAMQHLGVDEF 232          

HSP 2 Score: 73.1738 bits (178), Expect = 2.318e-12
Identity = 37/77 (48.05%), Postives = 52/77 (67.53%), Query Frame = 1
Query:  670 QESEAVERLGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPLMXLVKSQGSLYXLVHP-RSTXATSFPLLTGR 897
            ++ EA++ LG D F+VS D  +MQAA+G +DGIIDTVSA HP++PL+ L+K  G L  +  P +      FPL+ GR
Sbjct:  219 KKEEAMQHLGVDEFVVSTDPQQMQAAVGTLDGIIDTVSAPHPIVPLLSLLKPHGKLIVVGLPDKPLQLPVFPLIQGR 295          
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: CADH8_ARATH (Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.949e-84
Identity = 149/222 (67.12%), Postives = 170/222 (76.58%), Query Frame = 2
Query:   47 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSPSKRVKPLNVLALIPF 712
            K AFG AA+D SGVLSPF F+RR TGEKDV FKV  CGICHSDLH++KNEWG + YP+VPGHEIVGVVTEVG+KV+KFK G+KVGVGC+V SC SCDSC   +ENYCPK I TY   Y+D TITYGGYSD MV +E FV+RIP+  PLDA APLLCAGITVYSP++++GLDKPGM              VKFAKAMG KVTVISTS  KR + +N L    F
Sbjct:    7 KEAFGLAAKDNSGVLSPFSFTRRETGEKDVRFKVLFCGICHSDLHMVKNEWGMSTYPLVPGHEIVGVVTEVGAKVTKFKTGEKVGVGCLVSSCGSCDSCTEGMENYCPKSIQTYGFPYYDNTITYGGYSDHMVCEEGFVIRIPDNLPLDAAAPLLCAGITVYSPMKYHGLDKPGMHIGVVGLGGLGHVGVKFAKAMGTKVTVISTSEKKRDEAINRLGADAF 228          

HSP 2 Score: 72.0182 bits (175), Expect = 3.386e-12
Identity = 35/62 (56.45%), Postives = 46/62 (74.19%), Query Frame = 1
Query:  670 QESEAVERLGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPLMXLVKSQGSLYXLVHP 855
            +  EA+ RLGAD+FLVSRD  +++ AMG MDGIIDTVSA H L+PL+ L+K +G L  +  P
Sbjct:  215 KRDEAINRLGADAFLVSRDPKQIKDAMGTMDGIIDTVSATHSLLPLLGLLKHKGKLVMVGAP 276          

HSP 3 Score: 20.7866 bits (42), Expect = 3.386e-12
Identity = 9/18 (50.00%), Postives = 11/18 (61.11%), Query Frame = 3
Query:  831 KLVLXGAPEKHXSYQLPP 884
            KLV+ GAPEK     + P
Sbjct:  269 KLVMVGAPEKPLELPVMP 286          
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: MTDH_APIGR (Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.239e-82
Identity = 148/232 (63.79%), Postives = 170/232 (73.28%), Query Frame = 2
Query:   17 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSPSKRVKPLNVLALIPF 712
            M ++ E EHP  AFGWAARDT+G+LSPF FSRRATGEKDV  KV  CG+CHSD H+I N WG   YPIVPGHEIVGVVTEVGSKV K KVGD VG+GC+VGSCRSC+SC  + E++C   I TY S Y DGT+T+GGYSDTMVADEHF++R P+  PLD+ APLLCAGIT YSPL++YGLDKPG              AVK AKA G +VTVI  S SKR + L  L    F
Sbjct:    1 MAKSSEIEHPVKAFGWAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPGHEIVGVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTMTHGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGLDKPGTKIGVVGLGGLGHVAVKMAKAFGAQVTVIDISESKRKEALEKLGADSF 232          
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: CADH6_ORYSJ (Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CAD6 PE=2 SV=2)

HSP 1 Score: 248.825 bits (634), Expect = 1.523e-77
Identity = 120/214 (56.07%), Postives = 146/214 (68.22%), Query Frame = 2
Query:   41 HPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGL---DKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSPSK 673
            H +   GWAA D SG + PF F RR  G  DVT KV +CG+CH+DLH I N+WG  +YP+VPGHEI GVVT+VG+ V+ FKVGD+VGVGC+  SC  C+ C    ENYC KV +TY   + DG+ITYGGYS  +VA + FVVRIP+  PLDA APLLCAGITVYSP++ +G+   D  G              AVKF KA G+ VTVISTSP+K
Sbjct:    7 HTQTVSGWAAMDESGKIVPFVFKRRENGVDDVTIKVKYCGMCHTDLHFIHNDWGITMYPVVPGHEITGVVTKVGTNVAGFKVGDRVGVGCIAASCLDCEHCRRSEENYCDKVALTYNGIFWDGSITYGGYSGMLVAHKRFVVRIPDTLPLDAAAPLLCAGITVYSPMKQHGMLQADAAGRRLGVVGLGGLGHVAVKFGKAFGLHVTVISTSPAK 220          

HSP 2 Score: 63.1586 bits (152), Expect = 1.523e-77
Identity = 36/79 (45.57%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  664 P*QESEAVERLGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPLMXLVKSQGSLYXLVHP-RSTXATSFPLLTGR 897
            P +E EA E L AD+F+VS DQ +MQA    +D IIDTV+A H L P++ L+K  G L  +  P +     SFPL+ G+
Sbjct:  218 PAKEREARENLKADNFVVSTDQKQMQAMTRSLDYIIDTVAATHSLGPILELLKVNGKLVLVGAPEKPVELPSFPLIFGK 296          
BLAST of EY659296 vs. ExPASy Swiss-Prot
Match: MTDH_MEDSA (Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 7.778e-77
Identity = 134/232 (57.76%), Postives = 168/232 (72.41%), Query Frame = 2
Query:   17 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMXXXXXXXXXXXXXAVKFAKAMGVKVTVISTSPSKRVKPLNVLALIPF 712
            M ++PE E P  AFGWAARDTSG LSPFHFSRR  G+ DV+ K+ +CG+CHSDLH +KN+WG   YP+VPGHEIVGVVT+VG  V KF+VGD VGVG +V SC++C++C  DLE YCPK + TY S Y  GT TYGGYSD +V  + +VV+ P+  PLDA APLLCAGITVYSP+++YG+ +PG              A+KF KA G+KVTVISTSP+K  + ++ L    F
Sbjct:    1 MAKSPETELPLKAFGWAARDTSGTLSPFHFSRRENGDDDVSVKILYCGVCHSDLHTLKNDWGFTTYPVVPGHEIVGVVTKVGINVKKFRVGDNVGVGVIVESCQTCENCNQDLEQYCPKPVFTYNSPY-KGTRTYGGYSDFVVVHQRYVVQFPDNLPLDAGAPLLCAGITVYSPMKYYGMTEPGKHLGVAGLGGLGHVAIKFGKAFGLKVTVISTSPNKETEAIDKLGADSF 231          

HSP 2 Score: 82.0333 bits (201), Expect = 4.990e-15
Identity = 43/79 (54.43%), Postives = 57/79 (72.15%), Query Frame = 1
Query:  664 P*QESEAVERLGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPLMXLVKSQGSLYXLVHPRSTXATS-FPLLTGR 897
            P +E+EA+++LGADSFLVS+D ++M+AAMG MD IIDT+SA H LMPL+ L+K  G L  +  P      S FPL+ GR
Sbjct:  216 PNKETEAIDKLGADSFLVSKDPEKMKAAMGTMDYIIDTISAAHSLMPLLGLLKLNGKLVTVGLPSKPLELSVFPLVAGR 294          
The following BLAST results are available for this feature:
BLAST of EY659296 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 109
Match NameE-valueIdentityDescription
CADH7_ARATH3.973e-9667.14Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis th... [more]
MTDH_MESCR1.560e-9370.31Probable mannitol dehydrogenase OS=Mesembryanthemu... [more]
MTDH_FRAAN2.037e-9371.18Probable mannitol dehydrogenase OS=Fragaria ananas... [more]
MTDH3_STYHU2.356e-9062.44Probable mannitol dehydrogenase 3 OS=Stylosanthes ... [more]
CADH6_ARATH1.270e-8857.66Probable cinnamyl alcohol dehydrogenase 6 OS=Arabi... [more]
GEDH1_OCIBA1.083e-8665.09Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GE... [more]
CADH8_ARATH2.949e-8467.12Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis th... [more]
MTDH_APIGR1.239e-8263.79Mannitol dehydrogenase OS=Apium graveolens GN=MTD ... [more]
CADH6_ORYSJ1.523e-7756.07Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza... [more]
MTDH_MEDSA7.778e-7757.76Probable mannitol dehydrogenase OS=Medicago sativa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-E10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659296 ID=EY659296|Name=EY659296|organism=Citrus sinensis|type=EST|length=897bp
ATTAAATTCATTCTGAATGGGGCAAGCACCGGAGCAAGAGCACCCTAAGA
ACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTTCTCTCCCCCTTT
CACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGACATTCAAAGTAAC
TCACTGTGGGATATGCCATTCAGATCTTCACTTGATCAAAAATGAATGGG
GCAATGCCATTTACCCAATCGTCCCCGGACATGAGATTGTGGGCGTAGTG
ACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGGAGACAAAGTGGG
AGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATAGCTGCGCCATTG
ATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTATGCCAGCAAGTAC
CATGATGGAACCATCACATACGGAGGCTACTCTGACACTATGGTTGCCGA
TGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCACTTGACGCCACTG
CCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCCGTTGAGATTCTAT
GGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGGCTTGGGCGGTCT
ANGCCATGTCGCTGTCAAATTCGCAAAGGCTATGGGGGTTAAGGTGACTG
TGATCAGTACCTCCCCTAGCAAGAGAGTGAAGCCGTTGAACGTCTTGGCG
CTGATTCCTTTTTGGTCAGTCGTGATCAAGATGAGATGCAGGCTGCCATG
GGGCACATGGATGGTATCATCGATACAGTATCTGCAGTTCACCCGCTAAT
GCCGTTGATGGNACTGGTGAAATCTCAAGGAAGCTTGTACTTNCTGGTGC
ACCCGAGAAGCACTANAGCTACCAGCTTCCCCCTGCTCACGGGNAGA
back to top