EY659293

Overview
NameEY659293
Unique NameEY659293
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length913
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 2.104e-93
Identity = 173/200 (86.50%), Postives = 176/200 (88.00%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIENFKVESPNVKYTD+EIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGI WATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARV DIDLQK L P   S      +  P       GSR  +VIKG
Sbjct:    1 MFIENFKVESPNVKYTDHEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGICWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKG 200          
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 7.005e-89
Identity = 162/200 (81.00%), Postives = 173/200 (86.50%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVH+ +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLADAMARA+V DIDLQK L P   S      +  P       GSR  +VIKG
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHDEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMARAKVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKG 200          
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 2.038e-88
Identity = 162/200 (81.00%), Postives = 172/200 (86.00%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVHE +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDIS MNLADAMARA+V DIDLQK L P   S      +  P       GSR  +VIKG
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHEEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISGMNLADAMARAKVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKG 200          
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 2.662e-88
Identity = 161/200 (80.50%), Postives = 172/200 (86.00%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLADAMARARV+DIDLQK L P          +  P       GSR   VIKG
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANSVIKG 200          
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.321e-87
Identity = 160/200 (80.00%), Postives = 173/200 (86.50%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIE+FKVESPNVKYT+ EIHSVY+YETTELVHE+RNGTYQWIVKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDIS+MNLADAM RA+V+DIDLQK L P          +  P       GSR  +VIKG
Sbjct:    1 MFIESFKVESPNVKYTEGEIHSVYNYETTELVHESRNGTYQWIVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISNMNLADAMGRAKVLDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANNVIKG 200          
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 322.013 bits (824), Expect = 2.943e-87
Identity = 159/200 (79.50%), Postives = 173/200 (86.50%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIE+FKVESPNVKYT+NEI+SVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNP+D+VFGGWDISDMNLADAMARARV+DIDLQK L P   +      +  P       GSR   VIKG
Sbjct:    1 MFIESFKVESPNVKYTENEINSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPEDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMENMIPLPGIYDPDFIAANQGSRANSVIKG 200          
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 8.564e-87
Identity = 157/200 (78.50%), Postives = 172/200 (86.00%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIE+FKVESPNVKYT+NEIHSVYDY+TTELVHEN+NG +QW VKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLT GVIANREGISWATK+ VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNP++IVFGGWDISDMNLADAMARA+V+DIDLQK + P          +  P       GSR  HVIKG
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYQTTELVHENKNGAFQWTVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTAGVIANREGISWATKEKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPEEIVFGGWDISDMNLADAMARAKVLDIDLQKQMRPFMEHMVPLPGIFDPDFIAANQGSRANHVIKG 200          
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 4.699e-85
Identity = 159/201 (79.10%), Postives = 172/201 (85.57%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENR-NGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHE   NGTYQWIVKPKTVKY+FKTD+ VPKLGVMLVG GGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLADAMARARV+DIDLQK L P   +      +  P       GSR  HVIKG
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHEKTVNGTYQWIVKPKTVKYDFKTDIRVPKLGVMLVGLGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMENIVPLPGIFDPDFIAANQGSRANHVIKG 201          
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO1_ARATH (Inositol-3-phosphate synthase isozyme 1 OS=Arabidopsis thaliana GN=At4g39800 PE=2 SV=3)

HSP 1 Score: 314.694 bits (805), Expect = 4.699e-85
Identity = 159/201 (79.10%), Postives = 172/201 (85.57%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENR-NGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHE   NGTYQWIVKPKTVKY+FKTD+ VPKLGVMLVG GGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLADAMARARV+DIDLQK L P   +      +  P       GSR  HVIKG
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHEKTVNGTYQWIVKPKTVKYDFKTDIRVPKLGVMLVGLGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMENIVPLPGIFDPDFIAANQGSRANHVIKG 201          
BLAST of EY659293 vs. ExPASy Swiss-Prot
Match: INO1_BRANA (Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 1.367e-84
Identity = 154/200 (77.00%), Postives = 170/200 (85.00%), Query Frame = 1
Query:  286 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVVDIDLQKALGPTWXSWSHFWNL-*PXIHXLQSGSRXPHVIKG 882
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHEN NG YQWIVKPK VKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEE+YAPFKS++PMVNPDD+VFGGWDISDMNLADAM RA+V+DIDLQK L P   +      +  P       GSR  +VIKG
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENVNGAYQWIVKPKVVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEMYAPFKSLVPMVNPDDVVFGGWDISDMNLADAMGRAKVLDIDLQKQLRPYMENIVPLPGIYDPDFIAANQGSRANNVIKG 200          
The following BLAST results are available for this feature:
BLAST of EY659293 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_CITPA2.104e-9386.50Inositol-3-phosphate synthase OS=Citrus paradisi P... [more]
INO1_NICPA7.005e-8981.00Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_TOBAC2.038e-8881.00Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_WHEAT2.662e-8880.50Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_SESIN1.321e-8780.00Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO2_ARATH2.943e-8779.50Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]
INO3_ARATH8.564e-8778.50Probable inositol-3-phosphate synthase isozyme 3 O... [more]
INO1_PHAVU4.699e-8579.10Inositol-3-phosphate synthase OS=Phaseolus vulgari... [more]
INO1_ARATH4.699e-8579.10Inositol-3-phosphate synthase isozyme 1 OS=Arabido... [more]
INO1_BRANA1.367e-8477.00Inositol-3-phosphate synthase OS=Brassica napus PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-E07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659293 ID=EY659293|Name=EY659293|organism=Citrus sinensis|type=EST|length=913bp
TCTTTGTGCCGNATTCCCGGGCCGACCCCGCGTCCGCTAGTTTCGAAGTT
AAAAGATGTTGAGTCGAGTGGGAAGTGAGAATTGAGAAGGAGAGTCGAGT
TCGGAGACAGCAAGACGAAACAGCTCTTCTTCCAATAAATCTCAAAGCAT
TTGTTTGGTTTTATTTAAAGCAATTTTCTCAGCAAACTCTTCTTCTAATA
AATTTTAAAGCATTTGTTTGGTTTTTATTTAAAGCAATTTTCTCAGCGAA
GTTTTCAATTTTTTCTCTAAAATTTTCCTGGGAAAATGTTTATCGAAAAT
TTCAAGGTTGAGAGCCCAAATGTGAAGTACACAGATAATGAGATTCACTC
TGTGTACGATTATGAAACCACTGAGCTTGTTCATGAGAACAGAAATGGCA
CTTATCAGTGGATTGTCAAGCCCAAAACTGTCAAATATGAGTTCAAAACC
GATGTTCATGTCCCTAAACTTGGGGTTATGCTTGTGGGTTGGGGTGGAAA
CAACGGCTCAACTCTCACGGGTGGTGTTATCGCGAATCGAGAGGGAATCT
CCTGGGCCACAAAGGACACAGTGCAACAAGCCAATTATTTTGGTTCACTT
ACCCAAGCATCAGCAATTAGAGTTGGGTCTTACAATGGAGAGGAGATTTA
TGCTCCATTCAAGAGCATTCTCCCTATGGTGAACCCAGATGACATTGTGT
TTGGAGGATGGGACATTAGTGACATGAACTTGGCTGATGCCATGGCCAGG
GCTAGAGTGGTTGATATTGATCTTCAAAAAGCACTAGGNCCTACATGGNN
ATCATGGTCCCACTTCTGGAATCTATGACCCNTGATTCATNNGCTGCAAT
CAGGGTCCCGTNNGCCACACGTGATCAAGGGACCCAGNNAAGACAATGCN
TCAATCATCAAGA
back to top