EY659277

Overview
NameEY659277
Unique NameEY659277
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length911
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659277 vs. ExPASy Swiss-Prot
Match: Y4105_ARATH (Uncharacterized protein At4g01050 OS=Arabidopsis thaliana GN=At4g01050 PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 7.255e-19
Identity = 45/103 (43.69%), Postives = 58/103 (56.31%), Query Frame = 3
Query:  171 DAIGFIDSVIRFGTENPLALSGGVTILAAPLFLAQVLNN-PKSWGVESATDAYAHLGDDASCPAACVRGSGGISASHGP*CPELGEDAGLDCDKGDHKPGFLK 476
            D+ G I+ +  F T+NPL ++GGV  LA P  L+QVLN  PKSWGVESA +AY  LG D +     +R +        P    LG+ A      G+ KPGFLK
Sbjct:   87 DSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLSQVLNKKPKSWGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYNGEDKPGFLK 189          

HSP 2 Score: 31.5722 bits (70), Expect = 7.255e-19
Identity = 16/44 (36.36%), Postives = 23/44 (52.27%), Query Frame = 2
Query:  506 NATSSILDNLMGTLDWLLRR-APEGIQKCFTMSDGA*GPRGWMS 634
            N T  ILD   G  + +    A  G +  + + DGA GPRGW++
Sbjct:  200 NTTLYILDKFDGNSELVAELVALNGFKSAYAIKDGAEGPRGWLN 243          

HSP 3 Score: 21.557 bits (44), Expect = 7.255e-19
Identity = 8/12 (66.67%), Postives = 12/12 (100.00%), Query Frame = 2
Query:  110 QALTYEEALQET 145
            ++LTYEEALQ++
Sbjct:   68 KSLTYEEALQQS 79          
The following BLAST results are available for this feature:
BLAST of EY659277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y4105_ARATH7.255e-1943.69Uncharacterized protein At4g01050 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-D02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659277 ID=EY659277|Name=EY659277|organism=Citrus sinensis|type=EST|length=911bp
GCGGCTTCTGTCTTTATAAAACCACCCAGCATATCCTGCACAGTGTTGCG
CAAACATTGCGCATGGCGGCTTATTGCTGTTATCTTCAGTTGTTGGTTCT
GGCTTAACTCAAGCTTTAACATATGAAGAAGCGCTGCAGGAGACAGCAGC
GCTCTTCATCATCTGATGCTGATGCAATTGGGTTTATTGACAGCGTAATC
AGGTTTGGAACAGAGAATCCTTTAGCTCTATCTGGTGGTGTCACCATTTT
GGCTGCTCCATTATTTTTGGCTCAAGTTCTGAACAATCCTAAGTCATGGG
GTGTTGAGTCTGCGACGGATGCTTATGCACATTTGGGTGACGATGCGAGC
TGCCCAGCTGCTTGTGTAAGAGGCTCCGGCGGAATCTCGGCAAGTCACGG
GCCCTGATGTCCGGAGCTGGGGGAAGATGCCGGGCTCGATTGTGACAAAG
GTGACCATAAGCCGGGCTTCTTGAAGAACTGCCCTTGAAGCTCTAGGAAC
CAGCAAATGCTACATCGTCCATTCTAGACAATTTGATGGGAACTCTGGAC
TGGTTGCTGAGGCGGGCACCTGAGGGGATTCAAAAATGCTTCACTATGTC
AGATGGCGCATAAGGACCCCGGGGTTGGATGTCAATGGGCTTCCTTGGGT
CCCGGCTAAAAGACCTGGGGTCTTGGCCTGGGCTTTTTGTCCCAAACCTT
ACTTGGTGGATTGGAAATGGGGTGTGGGGGCTTCTGGGGTTCCTTTGCAT
TTGGGGCCCTGGAGATTGTGGGGTTCGGGGTTTCCNGGGCCGGACCCCTT
TGGGAATCAAAGCTCCGCGGCTCTGTGGACATGGCTACATAAACGCGCGT
TTGGGTGGCTCGGGAAAAACCTATCCCGGGTGGGGTTCCCGAAACCAGGG
TGCCCCTTATG
back to top